KEGG   Plasmodium yoelii: PY17X_0023600Help
Entry
PY17X_0023600     CDS       T01035                                 

Gene name
PY06185
Definition
(RefSeq) YIR protein
Organism
pyo  Plasmodium yoelii
SSDB OrthologParalogGFIT
Motif
Pfam: Cir_Bir_Yir Imm3 TcpS
Motif
Other DBs
NCBI-GeneID: 3792126
NCBI-ProteinID: XP_022810765
LinkDB All DBs
Position
Unknown
AA seq 277 aa AA seqDB search
MSSKVCKSINDIDKYFVDDPNNREEYNSRNFLNTFFPGSKCSSDEENIISGFILLISMFN
DIKDENIDSGKLIEYAILWLSYKLNKKKENGITTLNDFYTKHMENNSCYKENIDNTTDSN
SKIKKDVIEKKIKSMNIDIKDISNYYDPFKSLCNVYSELDPEKTQSKTCLENAREFFEKY
EKHINALDITKGDSYSQLWFSLLKDYKNFENNYNSLLCTNGPPFVACPRSSITKNILITI
AIIFVAASILLGVSYKYSLFGFRKRAQKQHLREKLKK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctaaagtgtgtaaatcaattaatgatattgataaatattttgttgatgatccg
aacaaccgggaagaatataattctaggaatttcttaaatacgtttttccctggtagtaaa
tgtagtagtgatgaagaaaatattatctctggttttatattgttaataagtatgtttaat
gatattaaagatgaaaatatagatagtggtaaacttattgaatacgctattttatggtta
agttataaactaaataaaaaaaaagaaaatggaatcactacattaaacgatttttatact
aaacatatggaaaacaatagttgttataaggagaatatagataatactactgatagtaat
agtaagattaaaaaggatgttatagaaaaaaaaataaaatcgatgaatattgatattaaa
gatatatctaattattatgatccatttaaatcattatgtaacgtgtatagtgaacttgat
ccagaaaaaacccaaagcaagacatgtttagaaaatgctagagaattttttgaaaaatat
gaaaaacatataaatgctttagatattactaaaggagattcttattctcaactatggttt
agtttattaaaagattataaaaattttgaaaataattataatagtcttttgtgtactaat
ggcccaccatttgtagcttgtccacgaagttcaataacaaaaaatatactaattacaatt
gcaattatatttgttgcagcatcaattttattgggagtttcttataagtattcgttattt
ggttttcggaaacgagctcaaaaacaacatttaagagaaaagctaaaaaaataa

DBGET integrated database retrieval system