KEGG   Plasmodium yoelii: PY17X_0407000Help
Entry
PY17X_0407000     CDS       T01035                                 

Gene name
PY05303
Definition
(RefSeq) FAD-dependent glycerol-3-phosphate dehydrogenase, putative
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pyo  Plasmodium yoelii
Pathway
pyo00564  Glycerophospholipid metabolism
pyo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pyo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PY17X_0407000 (PY05303)
Enzymes [BR:pyo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PY17X_0407000 (PY05303)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 Reovirus_L2 HI0933_like GMC_oxred_N 3HCDH_N Pyr_redox_3 GIDA
Motif
Other DBs
NCBI-GeneID: 3791078
NCBI-ProteinID: XP_725739
UniProt: A0A078K6T2
LinkDB All DBs
Position
4
AA seq 625 aa AA seqDB search
MLKKALVGAGGLGMISVGGVYLLKVNFHKNMIDKDVTYKYSPIGNRSEMINRLKTNQYDI
LIIGGGATGAGLALDCATRGIRCALIDRNDFSSGTSSKSTKLLHGGIRYLENAVKKLDIS
ELYFVWEALGERAHAMKIAPFMSRPVPILMPIYKLWQVPYFAYNIKIYDLLADLVCYFDK
GVPNSMYIQKQNTLDQFPLLHQDELKGSLVYYDGQHNDARMNLNLVLTSAIDNYVPGQVG
ATICNHMEVISFIMDENNKKIIGVRALDKINNKEIEIYAKVIINATGPQGDIIRKMADEN
SKPMIQVSVGCHFILPKWYSSKNNGMIIPKTSDGRVLFLLPWENNTIVGTTDEQRPLVDN
PKIAKKDTEFLATELSKYINVSPEEIKNDIKAAWCGFRPLVHDSKKQKKQKNNNDQDEIT
THEISRSHEIIEDENGLISILGGKWTIYRKMAQDTLDYVLSKHSDKIQNKNECRTKFLML
IGSHDQNGNLNHEDLTFGCSKLGKKLVDTYSEIDYETANYLVSNYGYLSEKVCELAKELK
LFNKIDQTKPYIEAEIVYASRYEFANTISDVIGRRFRLGFIDTHVSNQVIHKIANLLKDE
LNWSKDQMNKNIEEAKSYIDSLSLE
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaaggctctggttggagcgggagggctcggcatgatatccgttggaggcgtt
tacctacttaaggtaaactttcacaaaaatatgattgataaggatgtaacatacaagtat
agtccaattggtaatagatctgaaatgataaacagactaaaaacaaatcagtatgatata
ttaataattggtggaggagcaaccggggcaggtttagctttagattgtgcaacaagagga
ataagatgtgcactaattgacagaaacgatttttcaagtggaacttcttcaaaatcgact
aaattattacatggtggtattagatatttagaaaatgcagtaaagaaattagatatatca
gaattatattttgtttgggaagctttaggtgaaagagcccatgcaatgaaaattgcaccg
tttatgtctcgacctgttccgatattaatgcctatatataaattatggcaagttccttat
tttgcatataatataaaaatatatgatttattagctgatttagtttgttattttgataag
ggagtacccaattctatgtatatacaaaaacaaaacacattagatcaatttcctttgtta
catcaagatgaattaaaaggatctttggtatattatgatgggcaacataatgatgcacga
atgaatttaaatttagtattaacaagtgctatagataattatgtaccgggacaagtcgga
gctactatatgtaaccacatggaagttataagttttataatggatgaaaataataaaaaa
ataataggtgttagagctttagataaaattaataataaagaaattgaaatatatgcaaaa
gttattattaatgctacaggaccacaaggagatattattagaaaaatggcagatgaaaat
agtaaacccatgattcaagtatctgttggatgtcattttattttacctaaatggtattca
tctaaaaataatggaatgataatacctaaaacaagtgatggtagagtattatttttattg
ccttgggaaaataatacaattgttggaacgacagatgaacaacgacctttagtagataat
cccaaaattgctaaaaaagataccgaatttttagcaactgaattatctaaatatattaat
gtttctccagaagaaataaaaaatgatattaaagctgcttggtgtggatttcgaccttta
gttcatgattcaaaaaaacaaaaaaaacaaaaaaataataatgatcaagatgaaattaca
acacatgaaatatcaagaagtcatgaaattattgaagatgaaaatgggctaattagtata
ttaggtggaaaatggactatatatagaaaaatggctcaagatacacttgattatgtttta
tctaaacatagtgataagatacaaaataaaaatgaatgtagaactaaatttttaatgtta
attggtagtcatgatcaaaatggaaatttaaatcacgaagatttaacatttggatgtagt
aaattaggaaaaaaacttgttgatacatattcagaaattgattatgaaacagctaattat
ttagtatcaaattatggttatttatctgaaaaagtttgtgaattagcaaaagaattaaaa
ctatttaacaaaattgatcaaacaaaaccatatatagaagctgaaattgtatatgcaagt
agatatgaatttgctaatactatttccgatgttattggaagaaggtttagattagggttt
attgatacacatgtttcaaatcaagttatacataaaattgctaatttattaaaagatgaa
ttaaattggtctaaagatcaaatgaacaaaaatatcgaagaagccaaatcatatatcgat
tcattatctttagaataa

DBGET integrated database retrieval system