KEGG   Plasmodium yoelii: PY17X_0519300Help
Entry
PY17X_0519300     CDS       T01035                                 

Gene name
PY05468
Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pyo  Plasmodium yoelii
Pathway
pyo00020  Citrate cycle (TCA cycle)
pyo00190  Oxidative phosphorylation
pyo01100  Metabolic pathways
pyo01110  Biosynthesis of secondary metabolites
pyo01130  Biosynthesis of antibiotics
pyo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PY17X_0519300 (PY05468)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PY17X_0519300 (PY05468)
Enzymes [BR:pyo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PY17X_0519300 (PY05468)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 DAO Lycopene_cycl GIDA HI0933_like FAD_binding_3 NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 3791274
NCBI-ProteinID: XP_725930
UniProt: A0A078K508
LinkDB All DBs
Position
5
AA seq 631 aa AA seqDB search
MISRGVRKFNFIRSSYCHFSFTKNKAYDIIDHHYDAVIVGAGGAGLRSALELSKNKYKVA
CISKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGSDWLGDQNAIQYMCREAPE
SVIELEEFGLPFSRTKDGKIYQRAFGGQSLKYGKGGQAYRCAAAADRTGHAMLHTLYGQS
LSHNCIFFVEYFVLDLLMLNPEECIGVICINIADGKIHRFFSPHTVIATGGYGRAYLSCT
SAHACTGDGNAIVARSKLPLQDLEFVQFHPTGIYPAGCLITEGCRGEGGILRNREGEAFM
MRYAPKAKDLASRDVVSRAMTIEINENRGCGPNADHIYLDLTHLPHETIKERLPGIMETA
KIFAGVDVTKQYIPVLPTVHYNMGGIPTNYKTQVLTQSANFDKLTNNSTDDIIVKGLYAA
GEAASASVHGANRLGANSLLDIVVFGKRAALTIMEIDKPNIPKINPNTNIGEETIQRLDK
IRFNKGTIQTANIRKNMQVCMQKHAAVFRIGPLLDKGYKGILDICSQFKDVYINDKTLTW
NTDLLETLELENLLTLSAQTILAAINRKESRGAHARDDFPDRDDQNYLKHSLTWMTNRDV
EKSDFFTTYRSVNTKPLDNEMEYVPPVKRVY
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgatctcaagaggagtacgaaaattcaattttattcgttccagttactgtcatttttcc
ttcactaaaaataaagcatatgatattatagatcaccattatgatgctgtgattgtagga
gcaggtggtgcaggtttgagatcggctttagaattatcaaaaaataaatataaagtggca
tgtataagtaaattatttccaactcgatcacatacagtagcagcacaaggaggtataaat
gctgccttagggaatatgactgaggatgattggagatggcatgcttatgatactattaaa
ggatcggattggctaggtgatcaaaatgctattcaatacatgtgtagagaagcccctgaa
tctgttattgaattagaagaatttggtttacccttttctagaacaaaagatgggaaaata
tatcaaagggcttttggtggtcaaagtttaaaatacggtaaaggaggacaagcatataga
tgtgcagctgctgcagaccgaacaggacacgctatgttacatacattgtatgggcaatca
ttatcacataattgtatattttttgttgaatattttgtattagatttattaatgttaaat
cctgaggaatgtattggggttatatgcattaatattgcagatggaaaaattcatcgattt
ttttcaccacatacagttattgcaacaggtggatatggtagagcatatttatcttgtact
tctgcgcatgcatgtacaggtgatggtaatgctatagtcgctaggagtaaattgccttta
caagatttagaatttgttcaatttcatccaactggtatatatcctgctgggtgtttaatt
acagaaggttgcagaggagaagggggtattttgagaaatagagaaggggaagcatttatg
atgagatatgcaccaaaagctaaagatttagctagtcgagatgtagtgagtagagctatg
acaatagaaataaatgaaaatcgaggatgtggtcccaatgcagatcatatttatctagat
ctaacacatttgccacatgaaacaataaaagaaagattacctggtattatggaaacggct
aaaatttttgcaggtgtagatgtaacaaagcaatatataccagttttacctacagttcat
tataatatggggggtataccaactaattataaaactcaagtattaacacaatctgcaaat
tttgataaactcacaaataattcgacagatgatataatagttaaaggactttatgctgca
ggtgaagctgcatctgcatccgtacatggagctaatcgattaggtgctaattcgttatta
gatattgttgtatttggaaaaagagctgcattaactattatggaaattgataaaccaaat
attcccaaaattaatcctaatacaaatataggtgaagaaacaatacaaagattagataaa
ataagatttaataaaggtactattcaaacagctaatattagaaaaaatatgcaagtatgt
atgcaaaagcatgcagcagtttttcgaataggccctttattagataaagggtataaagga
atacttgatatttgttcacaatttaaagatgtttatattaatgataaaactttaacatgg
aatacagatttattagaaacattagaactggaaaatttattaacattatcagcccaaact
atattagctgctattaatcggaaagaatcaagaggggcacatgctcgtgatgatttccct
gatagagatgatcaaaactatttgaaacattccttaacatggatgacaaatagggatgtg
gaaaaatcggatttttttacgacatatagaagcgtaaatacaaaacctttagacaatgaa
atggagtacgtacctccagttaaacgtgtttattaa

DBGET integrated database retrieval system