KEGG   Plasmodium yoelii: PY17X_1338600Help
Entry
PY17X_1338600     CDS       T01035                                 

Gene name
PY03617
Definition
(RefSeq) uncharacterized protein
Organism
pyo  Plasmodium yoelii
SSDB OrthologParalogGFIT
Motif
Pfam: SAVED
Motif
Other DBs
NCBI-GeneID: 3789135
NCBI-ProteinID: XP_723801
LinkDB All DBs
Position
13
AA seq 584 aa AA seqDB search
MDKHLRMIARNIFVNGEMLWGRPKKCIEFFFDKKYITTNISENKEIKTKNIEHIKLRNFK
KNKNIIKDNNNNNDNEDAYVLNGKILYAPKNKKKQINELQIKSPAKKIKNIDNNTSNVYY
NKLGNNNIKKNNLIIQIDQTDAKLKREIEDVDNYTNKKERVSIKLNGDDDTNFKTTCFNN
NNNINLNLDTTIYNNYHHNNFSDINPNYTQNKKSAHINFLSKSDNTQNVESEFTQFSNTS
KSSIYNEVPLFNTLKAKEVSDNGIVNTMCNSSTNLGMITQNNFNLNSNVSSNSPQEKNNK
NDTIDTSLNNNNNNNNRDNKNNEEIKQDIYEVLNEINCSSNKKEIEVFLNNFFLYKSKKP
SSILGNYISFYFCNILSEDLRNLKHSCFDGVKLCVNTFLSTIKELDEKQLSKMTNIYLED
YFLKIFKILKEHNLNLHFDNITIDNIKLLYIYNILGITRNDGKRIKKENIKKFLYQYICV
DNKDIALLKNTTRMKFLSNIIKNGVTTRMHVLVNLSYDVSAYNTLTENCFIKTNFKNINL
ELVFENQLENPFFSLQSPDSIDLKSSGWYLVDVNQILNGNLPYE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacatctccgaatgattgctcgcaatatatttgtgaatggggaaatgctttgg
ggtaggccaaaaaaatgcatagaatttttttttgataagaaatatatcactacgaacata
tctgaaaacaaagaaataaaaactaaaaatatagaacatataaagctaagaaattttaaa
aagaataaaaatattataaaagataataataataataatgataatgaggatgcatatgtt
ctaaatggtaaaatattatatgcccccaaaaataaaaaaaaacaaataaatgaattacaa
atcaaatcacctgcaaaaaaaataaaaaacatagacaataatacaagcaatgtatattat
aacaaattaggtaataataacataaaaaaaaataacttaataattcaaatagatcaaaca
gatgcgaaattaaaaagagaaatagaagatgttgataattatacaaacaaaaaagaacga
gtatcaataaaattaaacggagatgacgacactaattttaagactacctgcttcaataac
aataataatatcaacttaaatttggataccacaatatacaataattatcatcataacaat
ttttctgatattaatccaaattatacacaaaataaaaaatcagctcatataaatttttta
agtaaatctgataatacacaaaatgttgaaagtgaatttacacaattttctaatactagc
aaaagtagtatatataatgaagttcctttattcaataccttaaaggccaaagaagttagc
gataatggtattgtaaataccatgtgtaatagctctacaaatctgggaatgataacgcaa
aataactttaacttaaattctaatgttagttcaaattctccacaagaaaaaaataataaa
aatgacacaattgataccagcctaaataataataataataataataatcgagacaataaa
aataatgaagaaataaaacaagacatttacgaggttctaaacgagataaattgcagctcg
aataaaaaagaaatagaagtttttttaaacaatttttttttatataaaagtaaaaaacca
tctagcatactaggaaattatataagcttttatttttgcaatatattaagtgaagattta
cgaaatttaaaacattcatgttttgatggagtaaaattatgtgttaatacctttttaagt
acaataaaagaattagatgaaaaacaactatctaaaatgacaaatatatatttagaagac
tattttttaaaaatatttaaaattttaaaagaacataatttaaatttacattttgacaat
ataacaatcgataatataaagttgttatatatatataatatattaggcataactcgaaat
gatggaaaaagaataaaaaaagaaaacattaaaaaatttttatatcaatatatatgtgta
gataataaagatattgccctattaaaaaatactactcgaatgaaatttttatcaaatata
attaaaaatggtgttacgacacgtatgcacgtgttagttaatctttcatatgatgtatca
gcatataatacgcttacagaaaattgctttattaaaacaaattttaaaaatattaattta
gagttagtatttgagaatcagcttgagaacccgtttttttctttacaatctccagattct
atagatttaaaatcctctggatggtatttggttgatgttaatcaaatattgaatggtaat
cttccatacgaatga

DBGET integrated database retrieval system