KEGG   Pyrococcus sp. ST04: Py04_0074Help
Entry
Py04_0074         CDS       T02124                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pys  Pyrococcus sp. ST04
Pathway
pys00620  Pyruvate metabolism
pys00680  Methane metabolism
pys00720  Carbon fixation pathways in prokaryotes
pys01100  Metabolic pathways
pys01120  Microbial metabolism in diverse environments
pys01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pys00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Py04_0074
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Py04_0074
   00680 Methane metabolism
    Py04_0074
Enzymes [BR:pys01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Py04_0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 PEPcase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AFK21680
UniProt: I3RBS0
LinkDB All DBs
Position
complement(68972..70366)
Genome map
AA seq 464 aa AA seqDB search
MSTQHPDNYSIPFFSHSPVLGGEDEITEAFYAYSVLGADEQMWDFEGKEVDEFVVKKLLE
RYPMFFKKKILGKDLRLTPRVPNPSVEKAEAKLLLETLQGITRAADYARIFYNDSIAPIF
EVILPMTTSSAELERVYQLYKKIVGISSEVIHDVTVGEWIGEFYPEEIRIIPLFETKSAL
LKSSRIVKEFLKDKDFEHQRVFFARSDPAMNYGLITAVTYVKKALYELAKLEEEMSISLY
PIVGVGGPPFRGGMRPDNVDVVLEEYPSVQTYTIQSSFKFDYPARDVVKAVDKIKSTKRR
APTPVDIPEFLTAYEVEYQNQIKLLAPHIRRLASRIPDRRRRKLHIGLFGYARNVNGLAL
PRAIKFTASLYSIGLPPELLALNSVTDKDLERVSEYYLHVYDDLEFAMKFFSFKVAEEVG
LKKLAERVREFKPDQIQEYVEEAELVFRGEGDVMKLAQMRGFLG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagtactcagcatccagacaattattcaatacccttcttttctcactctccagtactt
gggggagaggatgaaataacagaggctttttatgcttatagtgttcttggtgccgatgag
cagatgtgggactttgaaggaaaagaagtcgatgaattcgttgttaagaagttgcttgag
cgttatccaatgtttttcaagaagaaaatcctaggcaaagacttaaggctaaccccaaga
gttccgaacccctcggttgagaaggctgaggctaaattacttcttgagacgcttcagggt
ataacgagggctgctgactatgctcgaatattttacaatgactcaatagccccgatattc
gaagttatccttccaatgacgacgagctctgctgagcttgaaagggtgtaccagctttac
aaaaagatagttgggataagtagcgaggtaatacacgatgttacggttggtgagtggata
ggagaattctaccctgaggaaatcaggataattcctctttttgaaacaaaatctgcccta
ttgaagtcatctagaatagtgaaggaattccttaaagataaggattttgagcatcagagg
gttttctttgccagaagtgatcccgcgatgaattatggtctcataacggctgtaacttat
gtcaaaaaggctctgtacgagctggcaaagcttgaagaggagatgtcaatctccttatat
ccaatagtgggtgttgggggtcctccatttagaggaggaatgaggccggacaatgttgat
gttgttctcgaggagtatcccagcgttcagacatatacaattcagagctcatttaaattt
gattatcctgccagggatgttgtgaaggccgttgataagataaagtcaacgaaaaggaga
gctcctacgcccgttgatattccagagttcttaactgcctacgaagtggagtatcagaat
cagataaagctcttggctccccatattaggagactagcttcaaggattccagataggaga
agaagaaagttacatatagggttgttcggctatgcaagaaacgttaatggccttgctctt
ccaagagctattaagttcacggcatctctgtattccataggtctcccaccggagttgctg
gccttgaactcagtaacggataaagaccttgagagggtgtcagagtattaccttcacgtt
tatgacgacctcgagtttgctatgaagttcttctcattcaaagttgctgaagaggtcggt
ttaaagaagctcgccgagagggtgagggaattcaagcctgatcagattcaggaatacgtt
gaggaggcggaactcgtctttaggggagaaggggatgttatgaagctggctcagatgagg
ggattccttggataa

DBGET integrated database retrieval system