KEGG   Pyrococcus sp. ST04: Py04_0546Help
Entry
Py04_0546         CDS       T02124                                 

Definition
(GenBank) putative ATP dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
pys  Pyrococcus sp. ST04
Brite
KEGG Orthology (KO) [BR:pys00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Py04_0546
Enzymes [BR:pys01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Py04_0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AFK22148
UniProt: I3RD38
LinkDB All DBs
Position
complement(563365..564504)
Genome map
AA seq 379 aa AA seqDB search
MVSSRFKDILTSLGISEERIEILEAKGGIVEDEYEGLRYLRFKDSAGKLRRGTVVFDFDK
IILGFPHIKRVVNLEKGIRRIFKRGEFYVEEKVDGYNVRVTKVGERILAITRGGFICPFT
TERITDFVPEEFFKDNPNLVLVGEMAGPESPYLVEGPPYVKEDIKFFLFDVQEINTGKSL
PVEERLKLAEEYGIPHVEVFGKYTRDDIGELYALIEKLSEEGREGIVMKSPDMKKIVKYV
TPYANINDIKIGARVFYELPPGYFTSRISRLAFYIAERKIRDEELRKLAEDLGKALLQPF
VEGILDVEQGEEIAETFKIRVKKIETAYKMVTHFEKLGLNIEIVDIEEMDGLWRITFKRV
YSDATEKIKELVGGKAFVD
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtggtaagtagcagatttaaggatattctaacgagccttgggatctcggaagaaagaata
gaaattctcgaggccaagggagggatagtagaagacgaatacgaggggctaaggtactta
agattcaaggactctgcaggaaaactaagacgtggaacagtagtcttcgactttgataag
ataattctcggatttccccacattaagagggtcgtgaaccttgaaaaggggataaggagg
atcttcaaaaggggagaattctacgtagaagaaaaagttgatgggtacaacgtcagagtc
actaaagttggagagagaatattggcaataacccgcggtgggtttatctgcccattcaca
acagagagaataactgactttgttccagaggaattcttcaaggacaatccaaatttagtg
ctagttggggaaatggcaggaccagaaagcccttatctcgttgaaggccctccatatgtt
aaagaggacataaaattcttcttattcgacgtgcaagaaattaacactggaaaaagcttg
ccagtagaggaaagacttaaacttgccgaagagtatggaattcctcacgttgaagtgttc
ggaaagtacacaagagatgatataggagaactttacgccttaatagagaagctcagtgaa
gaggggagagaagggatagttatgaaaagcccagatatgaagaagatagtcaagtatgtc
actccatatgcgaatataaatgatatcaaaattggagcgagagtattttacgaactaccc
cctgggtacttcacaagcagaatatctaggctagccttctatatagcagagagaaaaatc
agagatgaagaattgagaaaactagcggaagatctaggaaaggccctgcttcaacctttt
gtcgagggaatcttagatgttgaacagggagaagaaatcgccgaaacgttcaagataaga
gttaagaagatagaaactgcatacaagatggttacccactttgagaagctcggtttaaac
atagaaatagtagatatagaagagatggatggactttggaggattacgttcaagagagtg
tactctgacgcaaccgagaagattaaggagctcgttggtggaaaagccttcgttgactga

DBGET integrated database retrieval system