KEGG   Pyrococcus sp. ST04: Py04_1077Help
Entry
Py04_1077         CDS       T02124                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
pys  Pyrococcus sp. ST04
Pathway
pys00010  Glycolysis / Gluconeogenesis
pys00020  Citrate cycle (TCA cycle)
pys00620  Pyruvate metabolism
pys00640  Propanoate metabolism
pys00650  Butanoate metabolism
pys00680  Methane metabolism
pys00720  Carbon fixation pathways in prokaryotes
pys01100  Metabolic pathways
pys01110  Biosynthesis of secondary metabolites
pys01120  Microbial metabolism in diverse environments
pys01130  Biosynthesis of antibiotics
pys01200  Carbon metabolism
Module
pys_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pys00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Py04_1077
   00020 Citrate cycle (TCA cycle)
    Py04_1077
   00620 Pyruvate metabolism
    Py04_1077
   00640 Propanoate metabolism
    Py04_1077
   00650 Butanoate metabolism
    Py04_1077
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Py04_1077
   00680 Methane metabolism
    Py04_1077
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Py04_1077
Enzymes [BR:pys01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Py04_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C PRA-PH
Motif
Other DBs
NCBI-ProteinID: AFK22652
UniProt: I3REJ2
LinkDB All DBs
Position
complement(1091861..1093051)
Genome map
AA seq 396 aa AA seqDB search
MPIRTVMKANEAAAWAAKLAKPKVIAAFPITPSTLVPEKISEFVANGELDAEFIKVESEH
SAISALVGAAAAGVRTFTATASQGLALMHEILFIAAGMRLPIVMAIGNRALSAPINIWND
WQDTISQRDTGWIQFYAENNQEALDLILAAYKVAEDERVLLPAMVGFDAFILTHTVEPVE
IPDQEVVDEFLGEYEPKHAYLDPQRPITQGSLAFPAHYMEARYLVWEAMERARKVIDEVF
AEFEKTFGRRYQKIEEYKTEDADIIFVTMGSLAGTLKEWVDKKREEGYKVGAAKMTVYRP
FPIEEIRELAKKTKVLAFIEKDISMGLYGAVFIDASAALINETEKPILLDFIAGLGGRDV
TFAQLDEALSIAEKALKEGKVEKPISWIGLRKELLE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgccgattagaactgttatgaaggctaatgaagcagccgcttgggctgccaagcttgct
aagcctaaggttatagcagcatttccaatcacaccttcaactctcgtccctgagaaaatt
agtgaattcgtagcaaacggagaactggacgcagaatttatcaaagttgagagcgagcat
tcagcaatctcagctcttgttggagccgccgcagcgggagttagaacgttcacagcaaca
gcttcacaaggtttggcgttaatgcatgaaattcttttcattgcggctggaatgagactg
ccaatagttatggcaattggaaacagagcactttcagccccaattaacatatggaacgac
tggcaggataccataagccagagagacacaggatggatacaattctatgcagaaaacaac
caagaagccttagatttaatcttagcagcttacaaagttgcagaagatgagagagttctt
ctcccagccatggttggattcgatgcatttatactaactcacacagttgaaccagttgag
attcctgaccaagaggtagttgacgagttcttgggagaatacgagcccaaacatgcgtat
ctcgacccacagaggccaataactcagggaagcctagcattcccagctcactacatggag
gcaaggtacttagtatgggaggccatggaaagagccagaaaagtcattgatgaagtgttc
gcagaatttgaaaaaacatttggaaggaggtatcagaagattgaagagtacaagaccgag
gacgcagatattatctttgtaacaatggggtcactcgcaggaacactcaaagaatgggtt
gacaagaagagggaagaaggctacaaggttggagccgcaaaaatgacagtttacagaccg
ttcccaattgaggagataagagaacttgcaaagaagaccaaagtcctcgcattcatagaa
aaggatattagtatggggctttatggagctgtatttatcgacgcctcagccgccctaatt
aacgaaaccgagaaaccaattcttctcgacttcatagctggtcttggtggaagggacgtg
acctttgcccagcttgatgaggctctcagcatagcggagaaggctctcaaagagggtaag
gttgagaagccaattagttggatcggattgagaaaggaacttttggagtga

DBGET integrated database retrieval system