KEGG   Pyrococcus sp. ST04: Py04_1155Help
Entry
Py04_1155         CDS       T02124                                 

Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pys  Pyrococcus sp. ST04
Pathway
pys00630  Glyoxylate and dicarboxylate metabolism
pys01100  Metabolic pathways
pys01120  Microbial metabolism in diverse environments
pys01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pys00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Py04_1155
Enzymes [BR:pys01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Py04_1155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N B12-binding
Motif
Other DBs
NCBI-ProteinID: AFK22729
UniProt: I3RER9
LinkDB All DBs
Position
1164319..1165581
Genome map
AA seq 420 aa AA seqDB search
MKVEWYLDFVDLEYSPGRDELIVEYYFEPNGVSPEEAAGRIASESSIGTWTTLWKMPEMA
KRSMAKVFYLEKKGDGYIAKIAYPLTLFEEGSLVQLFSAIAGNIFGMKAIKNLRLLDFHP
PYEYLRHFRGPQYGVNGIREFMGVHDRPLTATVPKPKMGWSVEEYAEIAYELWSGGIDLL
KDDENFTSFPFNRFEERVRKLYRVRDRVEAETGETKEYLINITGPVNVMEKRAEMVANEG
GQYVMIDIVVAGWSALQYMREVTEDLGLAIHAHRAMHAAFTRNPKHGITMLALAKAARMI
GVDQIHTGTAVGKMAGDYEEIKRINDFLLSRWEHIRPVFPVASGGLHPGLMPELIRLFGK
DLVIQAGGGVMGHPDGPKAGAKALRDAIEAAVDGIDLEEKAKSSPELRKALDKWGYLKPK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggagtggtatcttgattttgttgatttggagtattccccaggtagagacgag
cttatagttgaatactattttgaaccaaacggggtttcaccagaagaggccgctggaaga
atagcaagtgaaagttctatagggacatggacaactctatggaaaatgcccgaaatggca
aagagaagtatggcgaaggtattttacttagaaaagaaaggggatggatatatagcgaaa
atcgcatatccattaactctttttgaagaaggaagcttggttcagctttttagtgccata
gcaggcaacatatttggtatgaaagccataaagaacttgaggctcctagactttcatccc
ccttatgagtacctgaggcacttcagaggcccgcaatatggagtcaatggaattagagaa
ttcatgggagttcatgataggccactcacggcaaccgttccaaaaccgaaaatgggatgg
agtgttgaagaatatgccgaaatagcttatgaactctggagcggtggaatagaccttcta
aaggatgatgaaaacttcacgagctttccatttaataggtttgaagagagagtgagaaag
ctctacagagtgagagatagagtggaagctgaaacaggagaaactaaggagtacctaata
aacataacaggtccagttaacgtcatggagaaaagggcagagatggtggccaatgaggga
ggccagtacgtcatgatagacattgtagtggctggatggagtgctctgcaatatatgagg
gaagttacagaggatcttggcctagcaatacatgctcacagggctatgcatgctgcattc
actaggaatccgaagcatggcattacaatgcttgcgttggcaaaagccgccagaatgatt
ggagtggatcagatacatacgggaactgccgtagggaaaatggccggcgattacgaggaa
ataaaaaggataaacgacttcctcctaagcagatgggagcatataaggcccgtattcccc
gtcgctagtggagggcttcatcctggactgatgcctgaattgataaggctgtttggaaaa
gacctcgttattcaggctggaggaggagttatgggacatccggatggccctaaagcaggt
gctaaggctctcagagatgctattgaggctgcagtagatggaatagacctagaagagaaa
gcgaaatctagtccagagctgagaaaagccctggataagtggggttatcttaagccaaag
tga

DBGET integrated database retrieval system