KEGG   Pyrobaculum sp. WP30: PYWP30_00445Help
Entry
PYWP30_00445      CDS       T04013                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase, type 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pyw  Pyrobaculum sp. WP30
Pathway
pyw00620  Pyruvate metabolism
pyw00680  Methane metabolism
pyw00720  Carbon fixation pathways in prokaryotes
pyw01100  Metabolic pathways
pyw01120  Microbial metabolism in diverse environments
pyw01200  Carbon metabolism
Module
pyw_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pyw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PYWP30_00445
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PYWP30_00445
   00680 Methane metabolism
    PYWP30_00445
Enzymes [BR:pyw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PYWP30_00445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 PEPcase
Motif
Other DBs
NCBI-ProteinID: AKT34101
UniProt: A0A0K1DZR8
LinkDB All DBs
Position
383719..385143
Genome map
AA seq 474 aa AA seqDB search
MKNYKVFTSLRFMIPRLMCTQHPDATVKITSVEEVDEALVAFAAYGCEEVMVDYEGKTTP
YSQPKEIVAKCHQAELPLGERYFLTPRMPNPKLEEFERAMLTVEAALIANYFSVKLMGRQ
AVKWIVLPMVADVDTPHLVYRLLLRKQKIYEEELGTKWEPVEVIPLVEDAFAQLKVEDLL
GSLISKMEEKPKHVRLFLGKSDSAVKYGHLASSLAIVKLLSSLHRVEDRLGVKILPILGM
GSPPFRGGINNPRLVHMETVQYAGFNTVTVQSAVRYDVSYDEYSFVREVLLNACCLRTLR
LDVGGEVDTVITLASSNYRALLSKYAGKVAEVARLIPSTRERVSWTVYGRSVVAHDRVVN
MPRAIVYTATWYAMGLPPTLLDAPTIVELAKQDKLDAVLKALPTLKAELTYDAQFYDGAT
AEKYVGPELVKTVEEALDYLDIKERSGGIYQALLRSPRNESNVLAAGKYRKFLG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattataaagtcttcacatctctgagatttatgatccccaggctcatgtgtaca
cagcatccagacgccactgttaagatcacgtctgtagaggaggtggacgaggcgctggtg
gccttcgcggcgtatggctgcgaggaggtgatggtggactacgaggggaagacgacgccg
tattcccagcctaaggagatcgtggctaagtgccaccaggctgagttgccgttgggggag
cggtatttcttgacccccaggatgccgaaccccaagctggaggagtttgaaagagccatg
ttgaccgtggaggcggctctcatcgccaactacttctcggtgaagctgatggggcggcag
gcggtgaagtggatcgtgttgcctatggtcgccgacgtagacacgcctcatctcgtgtac
aggttgcttctacgtaagcagaagatctacgaagaggagctggggactaagtgggagcca
gtggaggtcattccgcttgtggaagacgcctttgcgcaactgaaggtcgaagatctcctc
ggctctttgatctccaagatggaggagaagccgaagcacgtcaggcttttcctcggtaag
tcggactccgccgtgaagtacggccacctcgcctcatccttggctattgtaaaactgctg
tcgtctcttcaccgcgtcgaggataggctgggcgttaagatattacccatattggggatg
gggtccccgcccttccgcggcgggataaacaacccacgtctggtgcatatggagacggtg
cagtacgccggcttcaacacagtgactgtgcagtccgccgtcagatacgacgtgtcttac
gacgagtacagctttgtgagagaggttctcctcaacgcctgctgtctgcggacgttgcgg
ctggacgtcggcggcgaggtggataccgtaattacactggcctcctccaactacagagcc
ctcttgtctaagtatgcaggtaaggtcgcggaggtcgctaggctcatcccgtcgacgagg
gagagggtgagctggacagtgtatgggaggtcggtggtggcccacgaccgggtggtcaac
atgccgagggctatcgtctacaccgctacgtggtacgccatgggtctgccgccgactctc
ctcgacgcccccaccattgtggagctggcgaagcaagacaagctggacgcagtgctgaag
gccttgccgactcttaaggctgagctgacctacgacgcgcagttttacgacggggccacc
gccgagaaatacgtggggcctgaactcgtcaagacagtggaggaggctctcgactaccta
gacataaaagagaggagtggcggcatataccaagccctcctccggtcgccgcgtaacgaa
tctaacgtgctcgccgccggtaaatacaggaagttcttgggatag

DBGET integrated database retrieval system