KEGG   Paracoccus zhejiangensis: CX676_02155Help
Entry
CX676_02155       CDS       T05233                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pzh  Paracoccus zhejiangensis
Pathway
pzh00240  Pyrimidine metabolism
pzh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pzh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CX676_02155
Enzymes [BR:pzh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CX676_02155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30
Motif
Other DBs
NCBI-ProteinID: AUH63106
UniProt: A0A2H5EUX1
LinkDB All DBs
Position
complement(428724..429296)
Genome map
AA seq 190 aa AA seqDB search
MAKLYFHFSTMNAGKSTLLLQASYNYRERGMETLLLTAALDDRAGEGRIASRIGIEDSAL
TFDAATDLFALIGRQGANSACIFVDEAQFLTPDQVWQLARVADDLGIPVMCYGLRVDFRG
ELFPGSAALLALADDLREVRTICHCGRKATMVIRRGADGAAIREGAQVQVGGNETYVSLC
RRHWREAMGQ
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttccatttctccaccatgaatgccggcaagagcacgctgctgctg
caagcctcctacaattaccgcgagcgcgggatggagacgctgctgctgaccgccgcgctg
gatgaccgcgccggcgaggggcgcattgccagccgcatcgggatcgaggacagcgcgctg
acctttgacgccgccaccgatctcttcgcgctgatcgggcggcagggggccaattccgcc
tgcatcttcgtcgacgaggcgcagttcctgaccccggaccaggtctggcagctggcccgc
gtcgccgatgacctggggatcccggtcatgtgctatgggctgcgcgtcgatttccgcggc
gagcttttccccggctcggcggcgctgctggcgctggctgatgacctgcgcgaggtgcgc
accatctgccattgcgggcgcaaggccaccatggtcatccgccgcggcgcggacggggcc
gccatccgcgagggtgcgcaggtgcaggtcggcggcaatgaaacctatgtctcgctctgc
cgccgccactggcgcgaggcgatggggcagtag

DBGET integrated database retrieval system