KEGG   Paracoccus zhejiangensis: CX676_05505Help
Entry
CX676_05505       CDS       T05233                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pzh  Paracoccus zhejiangensis
Pathway
pzh00020  Citrate cycle (TCA cycle)
pzh00190  Oxidative phosphorylation
pzh00650  Butanoate metabolism
pzh01100  Metabolic pathways
pzh01110  Biosynthesis of secondary metabolites
pzh01120  Microbial metabolism in diverse environments
pzh01130  Biosynthesis of antibiotics
pzh01200  Carbon metabolism
Module
pzh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pzh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pzh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pzh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CX676_05505
   00650 Butanoate metabolism
    CX676_05505
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CX676_05505
Enzymes [BR:pzh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CX676_05505
    1.3.5.4  fumarate reductase (quinol)
     CX676_05505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 FAD_oxidored GMC_oxred_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: AUH63682
UniProt: A0A2H5EWL2
LinkDB All DBs
Position
complement(1117057..1118859)
Genome map
AA seq 600 aa AA seqDB search
MDQYEIHTHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASL
GNMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQR
PFGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKHNAEFFIEYFALDLIITDGKC
TGVVCWKLDDGTIHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME
FVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLASRDVVSRCITIEI
REGRGVGEKKDHMFLNLMHLPPESLHERLPGISESAKIFAGVDVTREPIPILPTVHYNMG
GIPTNYWGEVLNPTEKHPDRIFPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR
AGEIIDRAAPIPATNKDAVDKIMVRFDSLRNANGSVPTAVLRDEMQRTMQADAAVFRTDK
TLAEGVEKMEAIAGKLRDVKVTDRSLIWNSDLMESLELENLMPNAMATIVAAEARKESRG
AHAHEDWPERDDANWRKHSLAWVDGNTVKLAYRPVHLDPLTKADEGGIDLKKIAPKKRVY
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggaccaatacgaaatccacacgcatgattacgacgtggttgtcgtcggtgccggcggc
gctggcctgcgcgccacgcttggcatggccgaacaggggctgcgcaccgcctgcgtgacc
aaggttttcccaacccgctcgcataccgttgcggcgcagggcggcatcgccgcctccctg
ggcaacatgggcccggacagctggcaatggcatatgtatgacacggtgaagggctcggac
tggctgggcgacaccgatgcgatggaatatctcgcgcgcgaggcgccgaaggcggtctac
gagctggaacattacggcgttcccttctcgcgcaccgaagagggcaagatctaccagcgt
cccttcggcggccacacgaccgaattcggcgaaggccccccggtgcagcgcacctgtgcc
gccgccgaccgcaccggccacgccatcctgcacacgctgtatggccagagcctcaagcat
aatgcggaattcttcatcgagtatttcgcgctcgacctgatcatcaccgatggcaaatgc
accggcgtcgtctgctggaagctggacgatggcaccatccacgtcttcaacgccaagatg
gtggtgctggcgaccggcggctatggccgcgcctatttcagcgccacctcggcccatacc
tgcaccggcgacggtggcggcatggtggcccgcgcaggcctgccgctgcaggacatggaa
ttcgtgcagttccacccgaccggcatctatggctcgggctgcctgatcaccgagggcgcg
cgcggcgagggcggttacctgaccaacagcgagggcgaacgcttcatggagcgttacgca
ccgacctacaaggatctggcctcccgcgacgtggtgtcgcgctgcatcaccatcgagatc
cgcgagggtcgcggcgtgggcgagaagaaggaccacatgttcctgaacctcatgcacctg
ccgccggaaagcctgcatgagcgcctgccgggtatctcggaatcggccaagatcttcgcc
ggcgtcgacgtgacgcgcgagccgatcccgatcctgccgacggtccattacaacatgggc
ggcatccccacgaactactggggcgaggtgctgaacccgaccgagaaacacccggaccgc
atcttcccgggcctgatggcggtgggcgaggccggctgcgcctcggttcacggggcgaac
cggcttggctcgaacagcctcatcgacctcgtggtctttggccgcgccgctgccatccgc
gccggcgagatcatcgaccgcgccgcgccgatcccggcgacgaacaaggatgccgtggac
aagatcatggtccgcttcgacagcctccggaatgccaatggttcggtgccgacggcggtc
ttgcgcgacgagatgcagcgcaccatgcaggccgatgcggcggtgttccgaaccgacaag
accctggccgagggcgtagaaaagatggaggcgatcgccggcaagctgcgcgatgtgaag
gttacggatcgcagcctgatctggaacagcgacctgatggaatcgctggaactggaaaac
ctcatgcccaacgcgatggcgaccatcgttgccgccgaggcgcgcaaggaaagccgcggc
gcccatgcgcatgaggactggcccgagcgggatgacgccaactggcgcaagcactcgctt
gcatgggtggacggaaacacggttaaactggcctatcgccccgtccatctcgatccgctg
accaaggcggacgagggcgggatcgacctgaaaaagatcgcgccgaagaaaagggtatac
tga

DBGET integrated database retrieval system