KEGG   Paracoccus zhejiangensis: CX676_10690Help
Entry
CX676_10690       CDS       T05233                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
pzh  Paracoccus zhejiangensis
Pathway
pzh00250  Alanine, aspartate and glutamate metabolism
pzh00410  beta-Alanine metabolism
pzh00640  Propanoate metabolism
pzh00650  Butanoate metabolism
pzh01100  Metabolic pathways
pzh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pzh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CX676_10690 (gabT)
   00650 Butanoate metabolism
    CX676_10690 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CX676_10690 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CX676_10690 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pzh01007]
    CX676_10690 (gabT)
Enzymes [BR:pzh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CX676_10690 (gabT)
Amino acid related enzymes [BR:pzh01007]
 Aminotransferase (transaminase)
  Class III
   CX676_10690 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AUH64570
UniProt: A0A2H5EZ54
LinkDB All DBs
Position
complement(2204671..2205939)
Genome map
AA seq 422 aa AA seqDB search
MSTMTDRKNAAISRGVGMTTQIYADRAENAEIWDKAGNRYIDFAAGIAVVNTGHRHPKVM
AAVRDQLDRFTHTCHQVVPYENYVELAERLNNLVPGDFPKKTIFATTGAEAVENAVKIAR
HYTGRPGIVAFAGGFHGRTFMGMALTGKVQPYKAGFGPMMNDVWHLPFPNPLHGVSEADA
LAALDRLFKADLEPGRVAAFIIEPVQGEGGFYEVPTSFVQKLREIADAYGILLIADEVQT
GFARTGKLFAMEHHGVAADLTTMAKGLGGGLPISAVTGRAEVMDSPNPGGLGGTYAGNPL
GVAAAHAVLDVIEEEGLNDRATRLGQRLKQRLAALRDEVPEIIDIRGPGFMNAVEFNVAG
SDKPNPDLANRVREEALKRNLILLTCGVYGNVIRFLAPLTIPDAVFDEALDILEDSIKAA
RG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgatgaccgaccgcaagaatgccgccatttcccgcggtgtcggcatgacgacg
cagatctatgccgaccgcgccgagaatgccgagatctgggacaaggcgggcaaccgctat
atcgacttcgccgccgggatcgccgtggtgaataccggccaccggcaccccaaggtgatg
gccgcggtcagggaccagctcgaccgcttcacccatacctgccaccaggtcgttccctac
gagaattacgtcgaactggccgagcggctgaacaacctcgtgcccggcgatttcccgaaa
aagaccatcttcgccaccaccggcgccgaggcggtcgagaacgcggtgaagatcgcgcgc
cattacactggccgcccgggcatcgtcgcctttgccggtggcttccatggccgcaccttc
atgggcatggcgctgaccggcaaggtccagccctacaaggccgggttcggaccgatgatg
aacgatgtctggcacctgcctttcccaaatccgctgcatggcgtcagcgaggcggacgcg
ctggcggcgctggaccggctgttcaaggccgatctggaaccgggccgggtcgcggccttc
atcatcgagccggttcagggcgagggcggtttctacgaggtgccgacgagcttcgtgcag
aagctgcgcgagatcgccgacgcttacggcatcctcctgatcgccgacgaggtgcagacc
ggctttgcccggaccggcaagcttttcgcgatggagcatcacggcgttgccgccgatctg
accaccatggccaaggggctgggcggcggtctgccgatcagcgccgtcaccggccgggcc
gaggtgatggacagccccaatccgggcggtctgggcggcacctatgccggcaaccccctg
ggcgtggcggcggcccatgcggtcttggacgtgatcgaggaagaggggctgaacgaccgc
gccacccgtctgggccagcggctgaagcagcgtctggctgccctgcgcgacgaggtgccc
gagatcatcgacatccgtggccccggcttcatgaacgcggtcgagttcaacgtcgcgggc
agcgacaagcctaaccccgaccttgccaaccgggtcagggaagaggcgctgaagcgcaac
ctgatccttctgacctgcggcgtttatggtaacgtcatccgcttcctcgcgccgctgacc
atccccgatgcggtcttcgacgaggcgctggatattctggaagacagcatcaaggccgcg
cggggctga

DBGET integrated database retrieval system