KEGG   Paracoccus zhejiangensis: CX676_12345Help
Entry
CX676_12345       CDS       T05233                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pzh  Paracoccus zhejiangensis
Pathway
pzh00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pzh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CX676_12345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pzh02000]
    CX676_12345
Enzymes [BR:pzh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CX676_12345
Transporters [BR:pzh02000]
 Other Transporters
  Pores ion channels [TC:1]
   CX676_12345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C Glutaredoxin GST_C_3 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AUH64862
UniProt: A0A2H5EZZ4
LinkDB All DBs
Position
complement(2550184..2550930)
Genome map
AA seq 248 aa AA seqDB search
MNGPLVSLGADAGVCVDGVCAIPEAAPKLTLISFPTCPYVQRAVIALRERGVEYEVIHVD
LANKPDWFLQISPLGKVPVLKIERAGEKPVILFESTVILQYLDETLPGQRLFPEDALDRA
RQRAWVEYAGSVLGELWKLVQARDEAGFTEARTALIARLQPLEAEVAGPFFAGAEFSAVD
AVFAPAFRQLDALETVRHLGVTDDLPKLQAWRQALAARPSVAGAVPPDFLDLYLGRLRAA
GSYALTAN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggccgctggtttcccttggcgcggatgcgggggtttgcgtggatggcgtctgc
gccatccccgaagccgcgccgaaactgacgctgatcagctttccgacctgcccctatgtc
cagcgcgcggtgatcgcgctgcgcgagcgcggggtcgagtacgaggtgatccatgtcgat
cttgccaacaagcccgactggtttctccagatctcgcccctgggcaaggtgccggtgctg
aagatcgagcgggcgggtgaaaaaccggtgatcctgttcgaaagcacggtcatcctgcaa
tatctggacgagaccctgccgggacagcggctgtttcccgaggatgcgctggaccgtgcc
cggcaaagggcctgggtcgaatatgccggctcggtgctgggcgagttgtggaagctggtg
caggccagggacgaggcgggcttcaccgaggcgcggacggcgctgatcgcgcggttgcag
ccgctcgaggccgaggtcgccggtccgttcttcgccggggccgaattctcggcggttgac
gcggtctttgcccctgccttccgccagctcgacgcgctcgagacggtgcggcatcttggc
gtgaccgatgacctgccgaagttgcaggcctggcggcaggcgctggccgcgcgtcccagt
gtcgccggcgcggtgccgccggatttccttgacctctatctgggccggttgcgcgcggcc
gggtcctacgcactgaccgcgaactga

DBGET integrated database retrieval system