KEGG   Phenylobacterium zucineum: PHZ_c0029Help
Entry
PHZ_c0029         CDS       T00750                                 

Gene name
fabA
Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00061  Fatty acid biosynthesis
pzu01100  Metabolic pathways
pzu01212  Fatty acid metabolism
Module
pzu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PHZ_c0029 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pzu01004]
    PHZ_c0029 (fabA)
Enzymes [BR:pzu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PHZ_c0029 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     PHZ_c0029 (fabA)
Lipid biosynthesis proteins [BR:pzu01004]
 Fatty acid synthase
  Component type
   PHZ_c0029 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ACG76443
UniProt: B4RBI3
LinkDB All DBs
Position
complement(25204..25731)
Genome map
AA seq 175 aa AA seqDB search
MRDVATRPSSYTLDELLACGRGEMFGDGNAQLPAPPMLMFDRITNITADGGAHGKGYVEA
ELDIRDDLWFFACHFIGDPVMPGCLGLDAMWQLVGFFLGWSGAPGKGRALGVGEVKFTGQ
VTPKVQKVTYKIDLKRVIMRKLVMGVGDGVLLADGKPIYEATDLRVGLFRAEDLA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacgtggcgacccggccctccagctacacgctcgacgagctcctggcctgcggc
cggggcgaaatgttcggcgacggcaacgcccagctgcccgcccccccgatgctgatgttc
gaccggatcacgaacatcaccgccgacggcggcgcccacggcaagggctacgtcgaggcc
gagctcgatatccgcgacgacctgtggttcttcgcctgccacttcatcggcgaccccgtg
atgcccggctgcctgggcctggacgccatgtggcagctggtcggcttcttcctcggctgg
tcgggggcgcccggcaagggccgcgccctgggcgtcggcgaggtgaagttcacgggccag
gtgacgccgaaggtccagaaggtcacctacaagatcgacctgaagcgcgtgatcatgcgc
aagctcgtgatgggcgtcggcgacggggttctgctcgccgacggcaagcccatctatgag
gcgacggatctgcgcgtgggcctgttccgggccgaagacctggcctga

DBGET integrated database retrieval system