KEGG   Phenylobacterium zucineum: PHZ_c0212Help
Entry
PHZ_c0212         CDS       T00750                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00020  Citrate cycle (TCA cycle)
pzu00190  Oxidative phosphorylation
pzu00650  Butanoate metabolism
pzu01100  Metabolic pathways
pzu01110  Biosynthesis of secondary metabolites
pzu01120  Microbial metabolism in diverse environments
pzu01130  Biosynthesis of antibiotics
pzu01200  Carbon metabolism
Module
pzu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pzu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pzu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PHZ_c0212 (sdhA)
   00650 Butanoate metabolism
    PHZ_c0212 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PHZ_c0212 (sdhA)
Enzymes [BR:pzu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PHZ_c0212 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     PHZ_c0212 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_oxidored Pyr_redox_3 FAD_binding_3 HI0933_like DAO SVIP
Motif
Other DBs
NCBI-ProteinID: ACG76626
UniProt: B4RD22
LinkDB All DBs
Position
209080..210867
Genome map
AA seq 595 aa AA seqDB search
MAAYEFIDHKFDVVVVGAGGSGLRAALGCAQAGLKTACITKVFPTRSHTVAAQGGISASL
GNMGEDDWRWHMYDTVKGSDWLGDQDAIEYLCRNAPAAVYELEHWGVPFSRTADGKIYQR
AFGGMTRNFGEAPIQRTCAAADRTGHAMLHTMYGQSLAHDTEFFIEFFALDLIMDEGVCR
GVTAWKLDDGTLHRFQAQMVILATGGYGRAYFSCTSAHTCTGDGGGMALRAGLPLQDMEF
VQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPTVKDLAPRDMVSRAMTIEIR
EGRGVGPNKDHIFLHLDHLDPKILAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNMGG
IPTNFYSEVVTKAGKNPDQVVPGLMAVGEAACVSVHGANRLGSNSLIDLVVFGRSAALRA
ADVLTPGASQPELKDHMTDGHLARFDRFRHAAGEVPTAELRLEMQRAMQEDAAVFRTGES
LTSGVKRLQAVHDKRKHIRVTDRSMIWNSDLMETLEFDNLVGQAAVTVNGAANRTESRGA
HAREDFPDRDDKKWMKHTLAWFDDKTGKVKLDDRPVHNFTMSNDIAYIPPKARVY
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggccgcttacgaattcatcgaccacaagttcgacgtcgtcgtcgtcggcgccggcggc
tcgggcctgcgggccgcgctcggctgcgcccaggcgggcctgaagaccgcctgcatcacc
aaggtgttcccgacccgctcgcacacggtcgccgcccagggcgggatctccgcttcgctg
ggcaacatgggcgaggacgactggcgctggcacatgtacgacaccgtcaaggggtcggac
tggcttggcgaccaggacgccatcgaatacctctgccgcaacgcgccggcggcggtgtac
gagctcgagcactggggcgtcccgttcagccgcacggccgacggcaagatctaccagcgc
gccttcggcggcatgacccgcaacttcggcgaggccccgatccagcgcacctgcgcggcg
gccgaccggaccggccacgccatgctgcacaccatgtacggccagtcgctggcccacgac
accgagttcttcatcgagttcttcgccctcgacctgatcatggacgagggcgtctgccgg
ggcgtcaccgcctggaagctggacgacggcaccctgcaccggttccaggcccagatggtc
atcctggccaccggcggctacggccgggcctacttctcctgcaccagcgcccacacctgc
accggcgacggcggcggcatggcgctgcgcgccggcctgccgctgcaggacatggagttc
gtccagtttcaccccacggggatctacggcgccggctgcctgatcaccgaaggcgcgaga
ggcgagggcggctacctgaccaactccgagggcgagcggttcatggagcgctatgcgccg
accgtgaaggacctcgcgccgcgggacatggtcagccgggccatgaccatcgagatccgc
gagggccgcggcgtcggtccgaacaaggaccacatcttcctgcacctggatcacctggat
ccgaagatcctggccgaacgtcttccggggatctcggaaagcgccaagatcttcgcaggc
gtcgacgtgaccaaggagccgatcccggtcctgccgaccgtccactacaacatgggcggc
atcccgacgaacttctactcggaggtggtgaccaaggccggcaagaatccggaccaggtg
gtgccggggctgatggcggtgggcgaggcggcctgcgtctcggtgcacggcgccaaccgg
ctcggctcgaacagcctgatcgacctcgtggtgttcggccgctcggcggcccttcgcgcg
gccgacgtcctgaccccgggcgccagccagcccgagctgaaggaccacatgaccgacggc
cacctggcccggttcgaccgcttccgccacgcggcgggcgaggttccgaccgccgagctg
cggctcgagatgcagcgggccatgcaggaggacgccgccgtcttccgcaccggcgagagc
ctgacgtcgggcgtcaagcgcctgcaggcggtgcacgacaagcgcaagcacatccgcgtc
accgaccgcagcatgatctggaactcggacctcatggagaccctggagttcgacaacctg
gtcggccaggcggcggtgacggtgaacggggcggccaaccgcaccgagagccgcggcgcc
cacgcccgcgaggatttccccgaccgcgacgacaagaagtggatgaagcacaccctggcc
tggttcgacgacaagaccgggaaggtgaagctggacgaccgtccggtgcacaacttcacc
atgtccaacgacatcgcctacatcccgccgaaggcgcgggtgtactaa

DBGET integrated database retrieval system