KEGG   Phenylobacterium zucineum: PHZ_c0213Help
Entry
PHZ_c0213         CDS       T00750                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00020  Citrate cycle (TCA cycle)
pzu00190  Oxidative phosphorylation
pzu00650  Butanoate metabolism
pzu01100  Metabolic pathways
pzu01110  Biosynthesis of secondary metabolites
pzu01120  Microbial metabolism in diverse environments
pzu01130  Biosynthesis of antibiotics
pzu01200  Carbon metabolism
Module
pzu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pzu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pzu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PHZ_c0213 (sdhB)
   00650 Butanoate metabolism
    PHZ_c0213 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PHZ_c0213 (sdhB)
Enzymes [BR:pzu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PHZ_c0213 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     PHZ_c0213 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_9 Fer4_7 Fer2 Sperm_Ag_HE2
Motif
Other DBs
NCBI-ProteinID: ACG76627
UniProt: B4RD23
LinkDB All DBs
Position
210893..211675
Genome map
AA seq 260 aa AA seqDB search
MAEIRLPKNSRVTQGRHHPAPAGAARTKTFKVYRYDPDDAANPRWDTYEVDVDACGPMVL
DVLIHIKNTMDPTLTFRRSCREGVCGSCAMNIGGRNTLACTHGWEEVPGQAVQISPLPHM
PVVKDLVPDLTLFYAQYASIEPWLHTKTPEPQTEWAQSPEDREKLDGLYECILCACCSTS
CPSYWWNQEKYLGPAALLHAYRWIIDSRDEATGERLDELEDPFKLYRCHTIMNCAQVCPK
GLNPAKAIGEIKKLLVDRVV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccgagatccgcctgcccaagaactcccgcgtcacccagggccgccaccacccggcg
cccgccggcgcggcccgcaccaagaccttcaaggtctaccgctacgacccggacgacgcg
gccaacccgcgctgggacacctacgaggtggacgtggacgcctgcggcccgatggtcctg
gacgtcctgatccatatcaagaacaccatggacccgacgctgaccttccggcgctcgtgc
cgggagggcgtctgcggctcgtgcgccatgaacatcggcggccgcaacacgctcgcctgc
acccacggctgggaggaggtccccggccaggccgtgcagatcagcccgctgccgcacatg
ccggtggtcaaggacctggtcccggacctgaccctgttctacgcccagtacgcctcgatc
gagccctggctgcacaccaagacccccgagccgcagaccgagtgggcgcagagccccgag
gaccgcgagaagctggacggcctctacgagtgcatcctgtgcgcctgctgctccacgagc
tgccccagctactggtggaaccaggagaagtacctggggcctgccgccctgctgcacgcc
taccgatggatcatcgactcgcgcgacgaggccaccggcgagcgcctggacgagctggag
gatcccttcaagctctaccgctgccacaccatcatgaactgcgcccaggtctgtcctaag
ggtctcaacccagccaaggccatcggggaaatcaagaagctgctggtggaccgggtcgtc
tga

DBGET integrated database retrieval system