KEGG   Phenylobacterium zucineum: PHZ_c0710
Entry
PHZ_c0710         CDS       T00750                                 

Definition
(GenBank) superfamily II DNA and RNA helicase
  KO
K17675  ATP-dependent RNA helicase SUPV3L1/SUV3 [EC:3.6.4.13]
Organism
pzu  Phenylobacterium zucineum
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pzu03029]
    PHZ_c0710
Enzymes [BR:pzu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     PHZ_c0710
Mitochondrial biogenesis [BR:pzu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PHZ_c0710
SSDB
Motif
Pfam: Helicase_C
Other DBs
NCBI-ProteinID: ACG77124
UniProt: B4RFP3
LinkDB
Position
complement(776754..779306)
AA seq 850 aa
MSDRPSGVAPPRLVAVLGPTNTGKTHLAVERMLGHQSGMIGLPLRLLAREVYDRIVKLRG
ARAVALITGEEKIVPPRPQYFVCTVEAMPLSVEVEFLAVDEIQLCADPERGHVFTHRLLH
ARGARETMLLGAGTMAPLVRRLLPHAEIQTRERLSALTYAGPKKLTRLPRRSAVVAFSAD
QVYAIAELIRRQRGGAAVVMGSLSPRTRNAQVALYQSGEVDFLVATDAIGMGLNMDVDHV
AFAGLRKFDGQRARLLHPQEIGQIAGRAGRFQKNGTFGVTGEAEDMDADLIEAVENHHFE
PVAGAEWRNSKLDFTSLPALMRSLAQTPEREGLKLAKEALDETTLRQLADDPDVARRARD
RHNLMRLWDVCQTPDFRKVASEEHMRLVKDFFFQLTAGRRRLSEDWIARQYAHLDRTDGE
IDMLSSRLASVRTLAYVANRPDWLADAGAWQAKTRALEDRLSDTLHEKLMARFVDRRTSA
LMRGLRVREEMLAGVAADGSVTVEGHFVGRLSGVQFEAAQGQSVLETKALRAAAHHAVGP
EIAKRLGRLAGEPDEAFRLSPDGTVLWQGEAAGVVTGGAPFSPRVRLLGELGHDAARQRA
QRRLEAFVAAEAARRLSPLRKLEVAVAEGKIRGLARGLAYRLIEAGGVLDRAEVRQDVGA
LSQVERRVLRGLGVRIGAFSLYMPGLLQPEARALAQAIASRETPGWTPASDAVSRLPQDQ
VSPRALSAYGLRAVRGLAVPVAQLERLDELMREAGQAAGASVLTEAAREALGWSKAEADA
ILRGLGFAPARKPRAGEPTAWRRRSAAKAEKAAAAPVHSPFAALAALKDQPPPARRSRRS
RRRKPKAAAL
NT seq 2553 nt   +upstreamnt  +downstreamnt
atgagcgaccgtccgtcgggcgttgcgccgccgcggctggtcgcggtgctcggccccacc
aacaccggcaagacccacctggcggtcgagcggatgctcggccaccagtccggcatgatc
ggcctgccgctgcggctgctggcccgcgaggtctacgaccggatcgtcaagcttaggggc
gcccgcgccgtcgccctgatcaccggcgaggagaagatcgtcccgccgcggccgcagtat
ttcgtctgcaccgtcgaggcgatgccgctgtccgtcgaggtcgagttcctggcggtggac
gagatccagctctgcgccgaccccgagcgcgggcacgtcttcacccaccgcctgctgcac
gcgcgcggcgcccgcgagaccatgctgctgggcgccgggacgatggccccgctggtccgc
cgcctgctgccgcacgccgagatccagacccgcgagcggctcagcgcgctgacctacgcc
gggccaaagaagctgacccgcctgccacggcgcagcgccgtggtggccttcagcgccgac
caggtctacgccatcgccgagctgatccgccgccagcgcggcggcgcggccgtggtgatg
ggatcgctgtcgccgcgcacccgcaacgcccaggtcgccctctaccagtccggcgaggtg
gacttcctcgtcgccaccgacgcgatcggcatgggcctgaacatggacgtcgaccacgtg
gccttcgcgggcctgcgcaagttcgacgggcagcgcgcgcgcctcctgcatccccaggag
atcggccagatcgccggccgcgccggccgctttcagaagaacggcacgttcggggtcacc
ggcgaggccgaggacatggacgccgacctgatcgaggcggtggagaaccatcacttcgaa
ccggtcgccggggcggaatggcgcaactcgaagctcgacttcaccagcctgcccgccctg
atgcgctcgctggcccagacgcccgagcgcgagggcctgaagctcgccaaggaggcgctg
gacgagaccaccctgcgccagctcgccgacgaccccgacgtcgcccgccgcgcccgcgac
cgccacaacctcatgcgcctgtgggacgtctgccagacgccggacttccgcaaggtggcc
tccgaggagcacatgcggttggtgaaggacttcttcttccagctcaccgccggccggcgg
cggctctcagaggactggatcgcgcgccagtacgcccacctcgaccgcacggacggcgag
atcgacatgctgtcgagccgtctcgcgagcgtccgcaccctggcctacgtggccaaccgg
ccggactggctggccgacgccggcgcctggcaggcgaagacccgcgccctcgaggaccgc
ctgtccgacaccctgcacgagaagctgatggcccggttcgtggaccggcggaccagcgcc
ctgatgcgcggcctgcgggtgcgcgaggagatgctggccggcgtggcggccgacggctcg
gtgacggtcgagggccatttcgtcggcaggctctccggcgtgcagttcgaggccgcgcag
ggccagagcgtgctcgaaaccaaggcgctgcgcgccgccgcccaccacgcggtcgggccc
gagatcgccaagcgcctcggccggctggccggcgagcccgacgaggcgttccggctctcc
cccgacgggaccgtgctgtggcagggcgaggccgccggcgtcgtcacgggcggcgcgccc
ttcagcccgcgcgtgcgcctgctgggcgagctgggccacgacgcggcccgccagcgcgcc
cagcggcggctggaggccttcgtggcggccgaggcggcccggcggctctcgcccctgcgc
aagctggaggtcgccgtcgccgaggggaagatccggggcctggcccgcggcctcgcctac
cggctgatcgaggccggcggcgtcctggaccgggccgaggtccgccaggacgtgggagcc
ctgtcccaggtggagcggcgcgtcctgcgcggcctgggcgtgcggatcggggcgttctcc
ctctacatgcctggcctgctgcagcccgaggcccgggcgctggcccaggcgatcgcctcg
cgcgagacgcccggctggaccccggcgagcgacgccgtcagccggctgccgcaggaccag
gtctctccgcgcgcgctctccgcctacgggctgagggcggtgcgcggcctggcggtgccc
gtcgcgcagcttgagcgcctggacgagctgatgcgcgaggcgggccaggcggccggcgcc
tccgtgctgaccgaggccgcccgcgaggccctcggctggagcaaggccgaggccgacgcc
atcctgcggggcctgggcttcgcccccgcgcgcaagcccagggcgggcgagcccaccgcc
tggcgtcgccgcagcgcggccaaggccgagaaggcggcggccgcgcccgtccattcgccg
ttcgcggcgctggccgcgttgaaggaccagccgccaccggcccgccgcagccgccggtcg
cggcgccgcaagcccaaggccgcggccctatga

DBGET integrated database retrieval system