KEGG   Phenylobacterium zucineum: PHZ_c1153
Entry
PHZ_c1153         CDS       T00750                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00970  Aminoacyl-tRNA biosynthesis
pzu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PHZ_c1153
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pzu03029]
    PHZ_c1153
Enzymes [BR:pzu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PHZ_c1153
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PHZ_c1153
Mitochondrial biogenesis [BR:pzu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PHZ_c1153
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: ACG77567
UniProt: B4R834
LinkDB
Position
complement(1322442..1323719)
AA seq 425 aa
MTPAEALARIRTYDPRLKAFVRVFDPPLLGEDLDGPTFAIKDLFDVAGVPTGGGAQVPLD
PSPTRHSRAVERLLQAGWSAVGKTHTVELAYGGWGTNRAVGAPWNPWDPKVHRAPGGSSS
GSAVAVAAGLCDAALGSDTGGSVRIPAAVCGVVGLKPGRGLVSLRGVHPLSPALDTVGTL
ARSVEMAARALAAISGPDGAAAVREPFDSEAALSMDVRGRRVAAIPLDDLGEVHPDVGRL
YLEAIERLRSAGVAVEMVRPPSALEQSFAPNGLLMAGEGWRIWGERIQRHAEVMDPWIVR
RFEAGRDVTDQRLEDVHRRRAEDQAAFHAWIAGWDGLLSPTCPIPAPPIDEVDETVSPLS
RLTRAANYLDLPGISVPCGLTGEGLPAGLQILGRPRDEASVVALGAAFERVSGWDGRAPD
LAGFA
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgacccccgccgaggccctcgcccgcatccgcacctacgatccccggctgaaggccttc
gtgcgggtcttcgatccgccgctcctgggcgaggacctggacgggcccaccttcgccatc
aaggacctgttcgacgtcgcgggcgtgcccaccggcggcggcgcccaggttccgctcgac
cccagcccgacccgccactcgcgcgccgtcgagcgcctgctgcaggccggctggagcgcg
gtcggcaagacccacacggtggagctggcctatggcggctggggcaccaaccgggccgtg
ggcgcgccctggaatccctgggatcccaaggtccaccgcgcgcccggcggatcctcctcg
ggctcggccgtggcggtcgcggcggggctctgcgacgccgccctcggctcggacaccggc
gggtcggtgcgcatcccggcggcggtctgcggcgtggtggggctgaagcccggccgcggc
ctcgtcagcctgcgcggcgtccatccgctcagccccgcgctggacaccgtgggaacgctc
gcgcggtctgtcgagatggccgcccgcgccctggccgccatctcgggccccgacggcgcg
gccgccgtccgcgagccgttcgactccgaagccgccctgtcgatggatgtgcgcggacgc
cgcgtcgcggccattcccctcgacgacctcggcgaggtccaccccgacgtgggccgcctc
tacctcgaggccatcgagcggttgcgctcggccggcgtcgccgtcgagatggtgcgcccg
ccctcggccctggagcagtccttcgcgcccaatggcctgctgatggccggggaaggctgg
cgcatctggggcgagcgcatccagcgccatgccgaggtgatggacccttggatcgtccgc
cgcttcgaggccggccgcgacgtcaccgaccagcgtctcgaggacgtccaccgccgccgg
gccgaggaccaggccgccttccacgcctggatcgccggctgggacggcctgctctcgccc
acctgccccatccccgcgcccccgatcgacgaggtggacgagaccgtctcgcccctcagc
cgcctgacgcgggcggccaactacctcgacctgccggggatcagcgtgccctgcggcctc
accggcgagggcctgccggcggggctgcagatcctgggtcggccgcgggacgaggcctcg
gtcgtggccctgggcgcggccttcgagcgcgtgtcgggctgggatggccgcgcgccggac
ctcgccggcttcgcctag

DBGET integrated database retrieval system