KEGG   Phenylobacterium zucineum: PHZ_c1546
Entry
PHZ_c1546         CDS       T00750                                 

Definition
(GenBank) ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PHZ_c1546
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pzu03011]
    PHZ_c1546
   03029 Mitochondrial biogenesis [BR:pzu03029]
    PHZ_c1546
Ribosome [BR:pzu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    PHZ_c1546
  Bacteria
    PHZ_c1546
Mitochondrial biogenesis [BR:pzu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PHZ_c1546
SSDB
Motif
Pfam: Ribosomal_S6
Other DBs
NCBI-ProteinID: ACG77957
UniProt: B4RAF0
LinkDB
Position
complement(1746258..1746926)
AA seq 222 aa
MGPGRRRRRGPKRDDEGGGGKPAEHGRLRIDGAGSARQSCSATPNFLALPGVFPYWPASS
RKAVSCGTRKGREPPGRRAESHRFRRTFRRRTRRPPNRKKELMALYEHVVISRQDISPQQ
AEALNDQLKALIEQGGGSVAKIEYWGLRNLTYRIKKNRKGHYSLLAIDAPADAVKEMERQ
LSINEDVLRYMTVRVDELDLELSPILARRDRERERRDDSPQF
NT seq 669 nt   +upstreamnt  +downstreamnt
ctgggaccaggccgccgcaggcgcagaggccccaagcgcgacgacgagggcggcggcggc
aagcctgcggaacatgggcgactccggattgatggggcaggttccgcaaggcagagctgc
agcgcaaccccgaatttccttgcccttccaggggttttcccctattggcccgcgtcttca
cggaaggcggtctcatgcggaacgcgaaagggccgggaaccccccggtcgccgcgctgag
agccatcgtttccggcggaccttccgccgccggacgcgccgccctcccaaccggaagaag
gaactgatggccctctacgaacacgtggtcatttcgcggcaggatatctcgccgcagcag
gccgaagccctgaacgaccagctgaaagccctcatcgaacaaggcggcggctccgtcgcc
aagatcgagtactggggtctgcgcaacctgacctaccggatcaagaagaaccgcaagggt
cactactccctgctcgcgatcgacgctccggcggacgcggtcaaggagatggagcgccag
ctgtcgatcaacgaagacgtcctgcgctacatgaccgtccgcgtggacgaactcgacctc
gagctctccccgatcctcgcccgccgcgatcgcgaacgcgaacgccgcgacgactctccg
caattctag

DBGET integrated database retrieval system