KEGG   Phenylobacterium zucineum: PHZ_c1662
Entry
PHZ_c1662         CDS       T00750                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K17662  cytochrome b pre-mRNA-processing protein 3
Organism
pzu  Phenylobacterium zucineum
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pzu03029]
    PHZ_c1662
Mitochondrial biogenesis [BR:pzu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PHZ_c1662
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-III assembly factors
    PHZ_c1662
SSDB
Motif
Pfam: Ubiq_cyt_C_chap
Other DBs
NCBI-ProteinID: ACG78073
UniProt: B4RB22
LinkDB
Position
complement(1867997..1868521)
AA seq 174 aa
MLRSLFKPRPARLAGRALYARVVEQSRTPALYADLGAPDTVEGRFEIYSLHVVLLLERLR
GHGEGAAEVSQALFDAYVKALDDALREMGVGDLSVGKKMRKLGEAFYGRGKNYQAALDAL
PDRGPLEAILRRTVYADASDRSAELADYVLAQREALAANPLERLIEGHVDWRTA
NT seq 525 nt   +upstreamnt  +downstreamnt
atgctccgaagcctgttcaagccccggcccgcccggctcgccggccgcgcgctctacgcg
cgggtcgtggagcagtcgcgcacgccggcgctctacgccgacctcggcgcgccggacacg
gtggagggccggttcgagatctacagcctgcacgtcgttctcctgctggagcgcctgcgc
ggccacggcgagggcgcggccgaggtctcccaggccctgttcgacgcctatgtgaaggcc
ctcgacgacgccctgcgcgagatgggggtgggcgacctgtccgtcggcaagaagatgcgc
aagctgggcgaggccttctacggccggggcaaaaactaccaggcggcgctggacgcgctg
cccgaccgcggcccgctggaggcgatcctgcgccgcaccgtctacgccgacgcgtccgat
cgctcggccgaactcgccgactatgtcctggcccagcgcgaggccctggccgccaatccg
ctggagcggctcatcgagggccatgtggactggaggacggcgtga

DBGET integrated database retrieval system