KEGG   Phenylobacterium zucineum: PHZ_c1835
Entry
PHZ_c1835         CDS       T00750                                 

Gene name
tyrS
Definition
(GenBank) tyrosyl-tRNA synthetase
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PHZ_c1835 (tyrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pzu01007]
    PHZ_c1835 (tyrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pzu03016]
    PHZ_c1835 (tyrS)
   03029 Mitochondrial biogenesis [BR:pzu03029]
    PHZ_c1835 (tyrS)
Enzymes [BR:pzu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     PHZ_c1835 (tyrS)
Amino acid related enzymes [BR:pzu01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   PHZ_c1835 (tyrS)
Transfer RNA biogenesis [BR:pzu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    PHZ_c1835 (tyrS)
 Prokaryotic type
    PHZ_c1835 (tyrS)
Mitochondrial biogenesis [BR:pzu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PHZ_c1835 (tyrS)
SSDB
Motif
Pfam: tRNA-synt_1b S4 TyrRSs_C
Other DBs
NCBI-ProteinID: ACG78246
UniProt: B4RCQ9
LinkDB
Position
2055408..2056664
AA seq 418 aa
MSDPAFKSEFLKTLQARGYIHQISHPQELDEATAGGVIAAYIGFDATATSLHVGSLIQIM
MLRRLQQAGHKPVVLMGGGTTKVGDPSGRDESRKMLTDADIERNIAGIRTVFEKFLTFGN
GPTDAVMVNNDAWLSKLGYLEFLREYGPHFTVNRMLTFDSVRLRLEREQPLTFLEFNYML
MQAVDFRHLNRTMGVQLQMGGSDQWGNIINGVELVRRMDQKAAFALTTPLLTTSSGAKMG
KTAQGAVWLNADLLSPYDYWQFWRNTEDADVGRFLRLFTDLPLDEIARLEALEGAQINDA
KKVLANEATRMLHGEEAARAAEAAARAAFEEGRLSGDLPTHEVARADLAAGIALAALAAD
AGLASSRGEARRLAQGGGLRVNDAQETDGARLVSEADLVDGVVKLAAGKKKIVLVKPV
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgtccgaccccgccttcaagtccgagttcctgaagacgctgcaggcgcgcggctacatc
catcagatcagccacccgcaggaactggacgaggcgaccgccggcggcgtgatcgccgcc
tacatcggcttcgacgcgacggcgacttcgctgcacgtcggcagcctgatccagatcatg
atgctgcggcggctgcagcaggcggggcacaagcccgtcgtgctgatgggcggcgggacc
accaaggtcggcgatcccagcggccgcgacgagagccgcaagatgctcaccgacgccgat
atcgagcggaacatcgccggcatccggaccgtgttcgagaagttcctgaccttcgggaac
gggcccaccgacgcggtgatggtcaacaacgacgcgtggctctcgaagctcggctacctg
gagttcctgcgggagtacggtccgcacttcaccgtcaaccgcatgctgaccttcgattcg
gtgcgcctgcggctcgagcgcgaacagccgctcaccttcctcgagttcaactacatgctg
atgcaggccgtggacttccggcacctcaaccggaccatgggcgtgcagctacagatgggc
ggctcggaccagtgggggaacatcatcaacggcgtggagctggtccggcggatggaccag
aaggccgccttcgcactgacgacgccgctgctgaccacctcctcgggcgccaagatgggc
aagaccgctcagggcgccgtgtggctgaacgccgacctgctcagcccctacgactactgg
cagttctggcggaacaccgaggacgcggacgtgggccgcttcctgcgcctgttcaccgac
ctgccgctggacgagatcgcgcggctggaggcgctggagggcgcgcagatcaacgacgcc
aagaaggtgctggcgaacgaggccacgcggatgctgcacggcgaggaggccgcgcgggcc
gccgaggccgccgcccgggccgcgttcgaggagggccgcctgtccggcgacctgccgacg
cacgaggtcgcccgggccgaccttgccgcggggatcgccctcgctgcgctcgcggccgac
gcggggctcgcttcctcgcggggcgaggcccggcgcctggcgcagggcggcgggctgcgg
gtgaacgacgcccaggagaccgacggcgcgcgcctcgtcagcgaggccgacctcgtggac
ggcgtcgtgaagctcgccgcgggcaagaagaagatcgtcctggtgaagccggtctga

DBGET integrated database retrieval system