KEGG   Phenylobacterium zucineum: PHZ_c1869
Entry
PHZ_c1869         CDS       T00750                                 

Gene name
era
Definition
(GenBank) GTP-binding protein Era
  KO
K03595  GTPase
Organism
pzu  Phenylobacterium zucineum
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pzu03009]
    PHZ_c1869 (era)
   03029 Mitochondrial biogenesis [BR:pzu03029]
    PHZ_c1869 (era)
Ribosome biogenesis [BR:pzu03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   PHZ_c1869 (era)
 Prokaryotic type
  GTPases
   PHZ_c1869 (era)
Mitochondrial biogenesis [BR:pzu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PHZ_c1869 (era)
SSDB
Motif
Pfam: MMR_HSR1 KH_2 FeoB_N RsgA_GTPase GTP_EFTU Dynamin_N PduV-EutP Arf MMR_HSR1_Xtn AIG1 cobW AAA_28 AAA_22 AAA_25 SRPRB AAA_29
Other DBs
NCBI-ProteinID: ACG78280
UniProt: B4RCU3
LinkDB
Position
complement(2096942..2097922)
AA seq 326 aa
MHAAEARRARARKGRRMSRAGFCAIIGAPNAGKSTLTNRLVGAKVSIVTQKVQTTRFPVR
GVAIAGDAQIVLVDTPGIFQPRRRLDRAMVRAAWGGAEDADAVVHLVDAAAQLGDKPADR
KAQADVDSIVEGLKKSGRKVILALNKIDAVKREALLDISKTLFDTGVYDEVFMVSATSGS
GVEDLKARLAALMPDNPWFYPEDQTADLPARLLAAEITREKLYLRLHEELPYSATVETTK
FEERPAPPDGDGGVRIEQTIFVEREGQRPIVLGKGGQTLKWIGQKAREELTAILDRPVHL
FLHVAVDERWADKREFYGPLGLDYDV
NT seq 981 nt   +upstreamnt  +downstreamnt
gtgcatgctgctgaagcgcgaagggcccgagcccggaaaggtcggagaatgagccgcgcc
ggtttctgcgccatcatcggcgcgcccaatgcgggcaagtccaccctgaccaaccgactg
gtcggggccaaggtctcgatcgtcacccagaaggtgcagacgacgcgctttcccgtgcgc
ggcgtggccatcgcgggcgacgcccagatcgtgctggtcgacacccccgggatcttccag
ccgcgccgccggctggaccgggccatggtccgcgccgcctggggcggggccgaggacgcc
gacgccgtcgtccacctggtcgacgccgccgcccaactcggcgacaagcccgccgaccgc
aaggcccaggccgacgtggactccatcgtcgagggcctgaagaaatccggccgtaaggtg
atcctggcgctgaacaagatcgacgcggtcaagcgcgaggcgctgctcgatatctccaaa
accctcttcgatacgggcgtttacgacgaggtcttcatggtctcggcgacctccggctcg
ggcgtggaggacctgaaggccaggctcgcggccctgatgcccgacaacccctggttctac
cccgaggaccagaccgccgacctgccggcccgcctgctggcggccgagatcacccgcgag
aagctctacctgcgcctgcacgaggagctgccctattcggccaccgtcgagacgacgaag
ttcgaggagaggcccgcgccccccgacggcgacggcggcgtgcgcatcgagcagaccatc
ttcgtcgagcgcgagggccagcggcccatcgtcctgggcaagggcggccagaccctgaag
tggatcggccagaaggcccgcgaggagctgaccgccattctcgaccgccccgtgcacctc
ttcctgcacgtggccgtggacgagcgctgggccgacaagcgcgagttctacggcccgctg
ggcctggactacgacgtgtga

DBGET integrated database retrieval system