KEGG   Phenylobacterium zucineum: PHZ_c2036Help
Entry
PHZ_c2036         CDS       T00750                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PHZ_c2036
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pzu02000]
    PHZ_c2036
Enzymes [BR:pzu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PHZ_c2036
Transporters [BR:pzu02000]
 Other Transporters
  Pores ion channels [TC:1]
   PHZ_c2036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ACG78447
UniProt: B4RE14
LinkDB All DBs
Position
complement(2279606..2280187)
Genome map
AA seq 193 aa AA seqDB search
MEIYGDSKSGNCLKVKWTADYLGRPYRWIELDVLKGESRTPQFLAINPAGQVPTVVLPGG
QPLAQSNAIILHLAEGSDLIPDAAYDRARMLEWMFWEQYSHEPYVAVARFQVRYLGKDPA
DLDPKLVERGQAALQRLEDGLVASPFLVGERLSLADVALVAYTRMAGEGGFRLADYPRVQ
AWIGRVEPALGIA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaaatctatggggactccaagtcggggaactgcctgaaggtgaagtggacggccgac
tacctgggccggccctaccgctggatcgagctggacgtgctgaagggcgagtcccgcacg
ccgcagttcctggcgatcaatccggccggccaggtccccacggtggtcctgccgggcggg
cagccgctggcccagtcgaacgccatcatcctgcacctcgccgagggctcggacctgatc
cccgacgcggcctacgaccgcgcccggatgctggagtggatgttctgggagcagtacagc
cacgagccctatgtcgccgtcgcccgcttccaggtgcgctacctgggcaaggacccggcc
gacctcgatcccaagctggtggagcgcgggcaggccgccctgcagcggctggaggacggc
ctcgtcgcctcgccgttcctggtgggcgagcgcctcagcctcgccgacgtcgcgctggtg
gcctacacccgcatggccggggagggcggcttccgcctcgccgactatccgcgcgtccag
gcctggatcggccgcgtcgagccggcgctcggcatcgcctga

DBGET integrated database retrieval system