KEGG   Phenylobacterium zucineum: PHZ_c2161
Entry
PHZ_c2161         CDS       T00750                                 

Definition
(GenBank) glucose-methanol-choline oxidoreductase
Organism
pzu  Phenylobacterium zucineum
SSDB
Motif
Pfam: GMC_oxred_C GMC_oxred_N FAD_binding_2 DAO Pyr_redox_2 FAD_oxidored NAD_binding_8 FAD_binding_3 HI0933_like Thi4 GIDA Amino_oxidase Lycopene_cycl ApbA
Other DBs
NCBI-ProteinID: ACG78572
UniProt: B4REP6
LinkDB
Position
complement(2431880..2433778)
AA seq 632 aa
MQGQPARPKALVRRSPPERVRPGVALRVLAGPQLPELRRLRGDASWRAGVSAPTSGLQLS
CFGGASVAATEPYDVIVVGSGAGGGMSAYHLTRSGLKVLMLEAGRDYDPVAETPMYNTNA
EAPLRGVSTPDKPFGFYDATVDGGWEVPNEPYTVAEGSEPFIWWRPRMLGGRTNHWGRIS
LRFGPLDFKPKSRDGLGHDWPITYDDLAPWYDRTEKLIGVTGAAPPRGLVNTPDSPPGCL
MESPPPRAFEIFYARAFEAMGIPVVPMHGAVVTQAMEGRNTCVFATPCGRGCAIGANFQS
TTVLIPPALATGNLTIRTNALVYQVDLDRTGKAKGVTFVDRATGAHHSVTARAVVLAAGS
GETARILLNSKSAAFPDGLCNAHGMVGRYLMDSVGVNVTGRFPALEDLPPTNDDGMSVSH
TYVPWWGYDRHEALGFPRGYHIEIGGGRQMPSMSVARLLEDDASVGEDLRAALRRRYGSV
ISFNGRGEMIPNDDCYCELDPQAKDKWGIPVLRFHWRWGEAETRQAAHMVTTFLEVIDRL
GGKPVGEVERDGRKAISKGGEMIHEVGTARMGASERDSVVNEYGQAWAVPNLFVTDGAVL
VSSPDKNPTLSILALAWRSSDHLANLAKRGEL
NT seq 1899 nt   +upstreamnt  +downstreamnt
ctgcagggacagccggctcgcccaaaggcgctcgttcggcgttctcccccggagcgggtc
cgccccggcgtcgccctgcgggtgttggcgggcccgcagcttccagagctacgccgcctg
cgcggtgacgcctcttggcgagcgggcgtgtcggcgccaacctcgggcctgcaactgtct
tgcttcgggggtgcaagcgtggccgcgaccgagccttacgacgtgatcgttgtcggctcc
ggcgccggcggcgggatgagcgcctaccacctgacgcgctcgggcctgaaggtgctgatg
ctggaggccggccgcgactacgacccggtcgccgagaccccgatgtacaacaccaacgcc
gaggcgcccctgcgcggggtctcgacgcctgacaagcccttcggcttctacgacgccacc
gtggacggcggctgggaggtgccgaacgagccctacaccgtggccgagggctccgagccc
ttcatctggtggcggccccggatgctgggcgggcggaccaaccactggggccgaatctcg
ctgcgcttcgggccgctggacttcaagccgaagagccgggacggcctgggccacgactgg
ccgatcacctacgacgacctcgctccctggtacgaccggaccgagaagctgattggggtg
acgggagcggcgccgccgcgcggtctcgtcaacacgccggactcgccgccgggctgcctc
atggaaagcccgccgccgcgcgccttcgagatcttctatgctcgcgccttcgaggccatg
ggcattccggtcgtgcccatgcacggggcggtggtcacccaggccatggaggggcgcaac
acctgcgtcttcgccacgccctgcggccggggctgcgccatcggggcgaacttccagtcc
acgaccgtgctgatcccgccggcgctcgcgaccggaaacctgaccatccggaccaacgcg
ctcgtctaccaggtcgacctggaccgcacgggcaaggccaagggcgtcaccttcgtcgac
cgcgccaccggcgcgcaccattccgtcaccgcccgcgcggtggtgctggccgccggctcg
ggcgagacggcgcgcatcctgctgaattccaagagcgcggcgtttcccgacggcctctgc
aacgcgcacggcatggtcggccgctacctgatggacagcgtgggcgtgaacgtcaccggc
cggttccccgcgctggaggacctgccgccgaccaacgacgacggcatgagcgtctcgcac
acctacgtgccctggtggggctacgaccggcacgaggccctcggctttccgcgcggctac
cacatcgagatcggcggcgggcggcagatgccctcgatgagcgtggcccgcctgctagag
gacgacgccagcgtcggcgaggacctgcgcgccgccctgcgccgccgctacggcagcgtg
atcagcttcaacggccgcggcgagatgatccccaacgacgactgctactgcgagctcgac
ccgcaggcgaaggacaagtggggcatcccggtcctgcgtttccactggcggtggggggag
gccgagacgcggcaggcggcccacatggtcacgaccttcctggaagtcatcgaccggctg
ggcggcaagccggtgggagaggtggagcgcgacggccgcaaggccatctcgaagggcggc
gagatgatccacgaagtggggacggcgcggatgggcgcctcggaacgggactcggtggtc
aacgagtacggccaggcctgggcggtcccgaacctgttcgtcaccgacggcgcggtgctg
gtctccagcccggacaagaacccgacgctgtcgatcctggcgctcgcctggcggtcgagc
gatcacctggcgaacctggccaagcggggtgagctgtga

DBGET integrated database retrieval system