KEGG   Phenylobacterium zucineum: PHZ_c2769Help
Entry
PHZ_c2769         CDS       T00750                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07090  uncharacterized protein
Organism
pzu  Phenylobacterium zucineum
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PHZ_c2769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ACG79178
UniProt: B4R860
LinkDB All DBs
Position
complement(3176419..3177228)
Genome map
AA seq 269 aa AA seqDB search
MTPMLVFLGIPPAVAVASMSNHVAASSMSSVIAYGRRRAVDLRMGGVLAAGGVVGAFLGV
ELFRLLRLLGQADLVVSVSYLVFLSIIGGLMLTESLGAILRRRRGEPNPPRRDRRPPWLY
GLPLKMRFPRSRLYISVIPPLVLGAFVGVLSAIMGVGGGFVLVPAMVYILRMPAGVVVGT
SLLQIIVTAVLTGVLQAGRNQTVDIVLATLLLLGGIVGAQYGARASARFRAEELRAVLAL
IVLFVGLRMGLGLFIAPEEPFVLMSGRLG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgatgctggtcttcctcggcatcccgccggccgtcgccgtggccagcatgtcg
aaccacgtcgccgcctcgtcgatgtccagcgtcatcgcctacggacgccgccgggccgtg
gacctgcgcatgggcggggtgctggcggcgggaggcgtggtcggggccttcctgggcgtc
gagctgttccgcctgctgcgtctcctgggccaggccgacctcgtggtgtcggtctcctac
ctcgtcttcctgtcgatcatcggcgggctgatgctgaccgagtcgctgggcgcgatcctg
cgccgccgccgcggcgagcccaatccgccgcggcgcgaccgccggccgccgtggctctac
ggcctgccgctgaagatgcgcttcccccgctcgcgactctacatcagcgtgatcccgccg
ctggtcctgggcgccttcgtgggcgtgctgtcggcgatcatgggcgtgggcgggggcttc
gtcctcgtgccggccatggtctacatcctgcggatgccggcgggggtggtggtcggcacc
agcctgctgcagatcatcgtcaccgccgtcctgaccggcgtgctccaggcgggccggaac
cagacggtggacatcgtgctggccaccctcctgctgctgggcggcatcgtcggcgctcag
tacggcgcccgggcctcggcccgcttccgtgcggaagaactccgcgccgtgctggcgctg
atcgtccttttcgtcggcctgcggatggggctgggcctgttcatcgcccccgaggagccg
ttcgtcctgatgtcggggaggctgggctga

DBGET integrated database retrieval system