KEGG   Phenylobacterium zucineum: PHZ_c3418Help
Entry
PHZ_c3418         CDS       T00750                                 

Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
pzu  Phenylobacterium zucineum
Pathway
pzu00620  Pyruvate metabolism
pzu01100  Metabolic pathways
pzu01120  Microbial metabolism in diverse environments
pzu01200  Carbon metabolism
Module
pzu_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:pzu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PHZ_c3418
Enzymes [BR:pzu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     PHZ_c3418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: ACG79827
UniProt: B4RC34
LinkDB All DBs
Position
complement(3869273..3871564)
Genome map
AA seq 763 aa AA seqDB search
MSDAEKRTFTDEEALSFHRLPRPGKIAIAATKPMATQRDLSLAYSPGVAVPVLKIADDPE
AAYDYTSKGNLVAVISNGTAILGLGDLGALASKPVMEGKGVLFKRFADVDAIDVEVASKD
ADEIITVVKNIGLTYGGINLEDIKSPECFRIETELQELLDIPVFHDDQHGTAIITAAGLI
NACEITGRKLSDIKVVLNGPGAAGIATLELIKAMGVPHDNVLAVDRKGVLWRGRPEDMNQ
WKSAHAVDTDKRTLAEALEGADVFIGLSAKGALNGELVRAMAPKPIIFAMANPDPEITPE
EVYKVRPDAIVATGRSDYPNQVNNVLGFPYIFRGALDVRARRVNMEMKIACARALAQLAR
EDVPDEVAAAYHGTQLKFGPEYIIPTPFDPRLIWYIPPFVAQAAMDTGVARKPIEDMDAY
RAALAQRLDPTAAFLQKLQGAVLSGPRKKVVFAEGEEPSVIRAAYAFQSAGLGEAILVGR
EELVHENMLLAGLSPAEAKLQVINARLSPWNEVFVDNLYARLQREGYLRRDVQRLINQDR
NAFAASMVALGHADGMVTGVTRAYDQVLEEVLRVIDPAPDGRVMGMSVVLAKGRTLFIAD
TNVTEMPEAQDLVEIAIEAARAVKTLGYRPRVAFLSYSAFGNPMGERSEKLREAVAMLDE
MDGVDFEYEGEMPPEIALEPERRGNYPFMRLTGPANVLIMPAIHSAAISTALLKSMGGAT
VIGPILLGLSKSVQICPLSASVSRILQQATLCAYDRPLAEVEL
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgccgaaaaacgcaccttcaccgacgaggaagcgctgagcttccaccgcctg
ccccgccccggaaagatcgccatcgcggcgaccaagcccatggccacccagcgggacctg
tcgctcgcctattcgccgggcgtcgccgtgccggtgctgaagatcgccgacgatcccgag
gcggcctacgactatacctccaagggcaacctggtggcggtgatctcgaacggcaccgcc
atcctgggcctcggcgacctgggcgccctggcgtcgaagccggtgatggaaggcaagggc
gtcctcttcaagcggttcgccgacgtcgacgccatcgacgtcgaggtggcctcgaaggac
gccgacgagatcatcaccgtggtcaagaacatcggcctgacctacggcggcatcaacctc
gaggacatcaagagccccgagtgcttccggatcgagaccgagctgcaggagctgctcgac
atcccggtcttccacgacgaccagcacggcaccgcgatcatcaccgccgccggcctgatc
aacgcctgcgagatcaccggccgcaagctgtcggacatcaaggtcgtgctgaacggcccg
ggcgcggccggcatcgcgaccctggagctgatcaaggcgatgggcgtgccgcacgacaac
gtgctggccgtggaccgcaagggcgtgctgtggcgcggccggcccgaggacatgaaccag
tggaagagcgcccatgcggtcgacaccgacaagcgcaccctggccgaggcgctggaaggc
gccgacgtgttcatcggcctgtcggcgaagggcgcgctgaacggcgagctggtgcgggcc
atggcgcccaagccgatcatcttcgccatggccaatccggacccggagatcacgccggaa
gaggtctacaaggtccggcccgacgcgatcgtggccaccggccgcagcgactatccgaac
caggtgaacaacgtcctgggcttcccctacatcttccgcggcgcgctcgacgtgcgggcc
cggcgggtgaacatggagatgaagatcgcctgcgcccgggcgctggcccagctcgcccgc
gaggacgtgcccgacgaggtcgccgccgcctatcacggcacgcagctgaagttcgggccg
gaatacatcatcccgacgccgttcgatccgcggctgatctggtacatcccgccgttcgtc
gcccaggcggccatggacaccggcgtggcccgcaagccgatcgaggacatggacgcctat
cgcgccgcgctggcccagcggctcgatcccaccgcggcgttcctccagaagctgcagggc
gcggtcctctcggggccgcggaagaaggtggtgttcgccgagggcgaggagcccagcgtg
atccgcgccgcctacgccttccagagcgccggcctgggcgaggcgatcctcgtcggccgc
gaggagctggtgcacgagaacatgctgctggccgggctgtcgcccgccgaggccaagctg
caggtgatcaacgcccgcctgtcgccgtggaacgaggtcttcgtcgacaacctctacgcc
cgcctgcagcgcgagggttatctgcgccgcgacgtccagcgcctgatcaaccaggaccgc
aacgccttcgccgcctcgatggtcgccctcggccatgccgacggcatggtcaccggcgtg
acccgcgcctacgaccaggtgctggaggaggtgctgcgggtgatcgatccggcgcccgac
ggccgggtgatgggcatgagcgtggtgctggccaagggccgcacgctgttcatcgccgac
accaacgtcaccgagatgcccgaggcccaggacctcgtggagatcgccatcgaggcggcc
cgggccgtgaagaccctggggtaccgcccgcgggtggccttcctcagctattcggcgttc
ggcaaccccatgggcgagcggtccgagaagctccgcgaggccgtggccatgctggacgag
atggacggcgtcgacttcgagtacgagggcgagatgcccccggagatcgctctcgagccc
gagcggcgcgggaactatcccttcatgcgcctgacgggcccggccaacgtgctgatcatg
ccggcgatccactcggccgcgatctcgacggcgctgctcaagtcgatggggggggccacg
gtgatcggcccgatcctgctcggtctctccaagtcggtgcagatctgcccgctgtcggcc
tcggtgtcgcgcatcctgcagcaggcgaccctctgcgcctacgaccgtccgctggcggag
gtggagctctga

DBGET integrated database retrieval system