KEGG   Quercus suber (cork oak): 111988415Help
Entry
111988415         CDS       T05868                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111988415
Enzymes [BR:qsu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     111988415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 111988415
NCBI-ProteinID: XP_023875972
LinkDB All DBs
Position
Unknown
AA seq 223 aa AA seqDB search
MQAALAAMAAQTILLSPSPPSHFSSSFHHPPPFLSSSTFRGSSLKLTRQSLTLSVSAATA
PKPLTVVAATKKAVAVLKGTSAVEGVVTLTQEDDGPTTVKVRVTGLTPGPHGFHLHEFGD
TTNGCISTGAHFNPNNLTHGAPEDEVRHAGDLGNIIANADGVAEATIVDNQIPLTGPNAV
VGRALVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTVPV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccgcactggcagccatggctgcccaaaccatcctcctctctccttctcctcct
tcccacttctcctcaagctttcaccacccacctcctttcctcagctcctccaccttccgt
ggctcctcccttaagctcactcgccaatccctcaccctctctgtctccgccgccacagct
cccaaacctctcaccgtcgtcgccgccaccaagaaagccgttgccgtcctcaagggcacc
tccgctgtcgaaggcgtcgtcacgttgacccaagaagacgatggtcccacgactgtgaag
gttcgtgttactgggcttactccagggcctcatgggttccacctacatgagtttggtgac
acaacaaatgggtgcatctctacaggggcacatttcaatcctaacaatttgacacatggt
gctcctgaggatgaagtccgtcatgcgggtgacctgggaaacataattgccaatgctgat
ggggtggcagaggcaacaattgtagataaccagataccattaactggtcctaatgcagtt
gttgggagagccctcgtggttcatgagcttgaggatgatcttggaaagggtggacatgaa
ctaagcctgaccactggaaacgcaggtggaagattggcttgtggcgtcgttggtttgact
gtaccagtgtaa

DBGET integrated database retrieval system