KEGG   Quercus suber (cork oak): 111994202Help
Entry
111994202         CDS       T05868                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu03030  DNA replication
qsu03410  Base excision repair
qsu03420  Nucleotide excision repair
qsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    111994202
   03410 Base excision repair
    111994202
   03420 Nucleotide excision repair
    111994202
   03430 Mismatch repair
    111994202
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:qsu03032]
    111994202
   03400 DNA repair and recombination proteins [BR:qsu03400]
    111994202
Enzymes [BR:qsu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     111994202
    6.5.1.6  DNA ligase (ATP or NAD+)
     111994202
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     111994202
DNA replication proteins [BR:qsu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    111994202
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     111994202
DNA repair and recombination proteins [BR:qsu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111994202
   NER (nucleotide excision repair)
    Other NER factors
     111994202
   MMR (mismatch excision repair)
    Other MMR factors
     111994202
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DUF5562
Motif
Other DBs
NCBI-GeneID: 111994202
NCBI-ProteinID: XP_023881843
LinkDB All DBs
Position
Unknown
AA seq 798 aa AA seqDB search
MLSVSLRSCYYYHRPSLSLSLSLSRSRSALKTLSSFLVSTKPFSSKNPNLTMSKPPSAFD
ALMSNARAAASKKKPQSSSPNKRKTLDSNPPQNPKTAKIPNSSPPGNAVSDAKPEESSGT
KQVKENGNCVQDPKLSGSEKKTKAISVEERVAQLKSKMPELKEKKAGDFDPRSVASWGEG
ERVPFMFLCLVFDMISNESGRILITDIVCNMLRTVMVTSPDDLVPIVYLSANRIAPAHEG
LELGIGDASIIKALAEAFGRTEVQVKKQYQVLGDLGLVAKASRSSQSMMRKPDALTVTKV
FNTFQLIAKESGKDSQEKKKNHIKGLLVAATDCEPQYLIRLLQAKLRIGLAEQTLLAALG
QAAVHTQKDSTPPPNIQSPLEEAVKIVKQAYSLLPVYDKIVPALLSGGVWNLPKTCNFTP
GVPVGPMLAKPTKTVQEIVRKFQDSEFTCEYKYDGERAQIHYMDNGSVEIYSRNAERNTG
KFPDVVIAVSRLKKSSVRSFVLDCELVAYNREKQIILPFQTLSTRARKNVDVSDIKVDVC
IFAFDMLYLNGQPLLQEELKVRREHLYGSFEEEAGFFQFATAITSNDLDEIQKFQDCAVN
ASCEGLIIKTLTKDATYEPAKRSLNWLKLKKDYMDNLGDSLDLVPIAAFYGRGKRTGLYG
AFLLACYDSNNEEFQSICKIGTGFSEEVLEKCSTNLTSKVIPEPKSYYRYADSMNPDVWF
EPAEVWEVKAADLTISPVHRAAVGIVDPDKGISLRFPRLMRVREDKKPEESTSAEQVAEM
YNSQKHNHPNDQDDDEDD
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgctctcagtctcactacgttcatgctactactaccaccgcccttcactctcactctca
ctctcactatctcgctctcgctcagctctcaaaaccctctcttcctttctcgtctccaca
aaacccttctcttccaaaaaccctaacctcacaatgtcgaagcccccttccgctttcgac
gcactcatgtccaacgcacgcgccgccgcctccaagaaaaagccccaatcttcttctccc
aacaagcgcaaaaccctagattccaaccctccccaaaaccccaaaaccgccaaaatcccc
aattcttcgccgcccggtaacgccgtttccgacgcgaaacccgaagaatctagcgggacc
aagcaagttaaagagaacggaaactgtgttcaagatcctaaattgtctgggtcggagaag
aagacgaaggcgatcagcgtggaggagagggttgcgcaattgaagagcaaaatgccggaa
ctgaaggagaagaaagctggagatttcgatccgagatcggtggcgagttggggcgagggc
gagcgtgttccgttcatgtttctgtgtttggttttcgacatgatttcgaacgagtcgggg
cggattttgattacggatattgtgtgcaatatgctgaggactgtgatggttacatcccca
gatgaccttgtgccgattgtgtatctttcggccaataggattgccccggcgcacgaaggg
ttggagcttggaattggggatgcttccataattaaggcgcttgccgaggcatttgggagg
actgaggtgcaggttaaaaagcaataccaggttttgggagacttgggtcttgttgcgaaa
gcaagccgttcatctcaatctatgatgcgcaaacctgatgccttaactgttaccaaggtt
tttaatacattccagctcattgctaaggaatctgggaaggatagtcaagagaagaaaaaa
aaccacatcaagggactacttgttgctgccaccgattgtgagcctcaatatctaattcgt
ctacttcaggcaaagttgcgtattggattggcagagcagactctattagctgcattgggt
caagctgctgtacatacccaaaaagattctacaccacctccaaacatccagtctccttta
gaagaggctgtgaagattgttaaacaagcatactctctacttcctgtctatgataaaata
gtccctgcacttcttagtggtggtgtgtggaatctcccaaagacatgtaactttacacct
ggtgtcccagttggacctatgctagcaaagccaactaagacggtacaggagattgtacgt
aaattccaggattctgagtttacctgtgaatataagtatgatggagaacgtgcccagata
cattacatggataatggttcagttgagatatacagtcgaaatgctgaacggaacactgga
aagtttcctgatgttgtcattgcagtttcaaggttaaagaagtcatctgttagatcattt
gttctggattgtgaacttgttgcttataaccgtgaaaaacagattattcttcccttccag
accctcagcactcgagctcgtaaaaatgtggatgtgagtgatatcaaggttgatgtttgc
atatttgcttttgatatgttatatcttaatggccaaccgcttcttcaggaggaacttaaa
gttcgtagggagcatctatatggctcttttgaggaagaagctggattttttcagtttgcg
actgcaataacatcaaatgatttagatgaaatacagaaatttcaagactgtgcagttaat
gcaagttgtgagggtttaattatcaaaacattgactaaagatgctacatatgagcctgca
aagcggtcacttaactggctaaaattgaagaaagattacatggataatttaggggactcg
ctagatttggtacctattgctgctttctatggccgtgggaagcgtacaggattgtatggt
gcctttctccttgcttgttatgacagcaataatgaagaatttcaaagcatttgtaaaata
ggcactgggttttctgaagaagtgcttgaaaaatgttctaccaatctcacttctaaagtg
attcctgaaccaaagtcatactaccggtatgcagattcaatgaatccagatgtatggttt
gaacccgctgaggtctgggaggtgaaagctgcagacttgaccattagccctgttcatcgt
gctgcagttggcatagtggatccagataagggcatttctcttcgatttcctcggctgatg
cgtgtccgtgaagataagaaaccagaggagtccacatcggctgagcaggtggctgagatg
tataattctcaaaagcacaatcatcccaatgatcaagatgatgatgaagatgattga

DBGET integrated database retrieval system