KEGG   Quercus suber (cork oak): 111999635Help
Entry
111999635         CDS       T05868                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00020  Citrate cycle (TCA cycle)
qsu00190  Oxidative phosphorylation
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
qsu01200  Carbon metabolism
Module
qsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
qsu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
qsu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111999635
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111999635
Enzymes [BR:qsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111999635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_16 Fer4_4 Fer4_18
Motif
Other DBs
NCBI-GeneID: 111999635
NCBI-ProteinID: XP_023887531
LinkDB All DBs
Position
Unknown
AA seq 301 aa AA seqDB search
MSKSWLRHGYNKVSRMVGRADTKKKDFPVLEGHPVGQTHAEQAVETHGTIQSNIKRLMKE
FKIYRWNPDHPNNKPYLESHFVDLSNCGPMVLDVLQNIKVEDDPSLTYRRSCRQGICGSC
AMNIDGTNTVACLKPIDPDTSRPTFITHLPPMFVIKDLVADLTNFYQQYKLIEPWLKTRK
APEDGREYRQSPKDRKKLDGFYECILCAFCTTSCPSYWWNPEEFLGPAAFFQAYRWISDC
RDDFTDERLQALTEDHRRLYRCRTIKNCTATCPKSLNPAYAIHKMKSKHLLSPPVERIES
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaagctggcttcgacatggctacaacaaggtgtcacgtatggttggcagggca
gacacaaagaagaaagactttccggtactggaaggccaccctgtgggccaaacacatgca
gagcaagctgttgagacccatggcaccatccaaagcaacatcaaaagactcatgaaggag
ttcaagatctataggtggaaccctgaccatcccaacaacaagccctacctagagtcccac
tttgtcgacctctccaactgtggaccaatggttttggatgtattacaaaatatcaaagta
gaggacgatccaagcttgacctataggaggtcttgcagacaaggaatttgcgggtcttgt
gctatgaatattgatggaaccaacactgtggcatgcctcaagcccattgatccagacact
tccaggcccacttttataacccatctacctcccatgtttgtcatcaaagatcttgtcgct
gatctcactaatttctaccagcaatacaagttgattgagccatggctaaaaacaagaaaa
gctccggaggatggacgggaatacaggcaatcacccaaggatagaaagaagctagatggg
ttttatgagtgcatactatgtgctttctgtactacttcatgcccttcctattggtggaac
cctgaggagttcctgggtcctgcagctttttttcaagcctatagatggatttctgactgt
cgggatgacttcacggatgaacgattgcaagccttaacagaggatcataggagattatat
agatgcaggactattaagaattgcacagccacttgccccaaaagcctcaatcctgcatat
gccattcacaagatgaagtctaagcatctcctttctccgccagtcgaaagaattgagagt
ttgtaa

DBGET integrated database retrieval system