KEGG   Quercus suber (cork oak): 112004421Help
Entry
112004421         CDS       T05868                                 

Definition
(RefSeq) glutamate decarboxylase 1 isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00250  Alanine, aspartate and glutamate metabolism
qsu00410  beta-Alanine metabolism
qsu00430  Taurine and hypotaurine metabolism
qsu00650  Butanoate metabolism
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
Module
qsu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    112004421
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    112004421
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112004421
   00430 Taurine and hypotaurine metabolism
    112004421
Enzymes [BR:qsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     112004421
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 112004421
NCBI-ProteinID: XP_023892437
LinkDB All DBs
Position
Unknown
AA seq 500 aa AA seqDB search
MVLSKATSNSDDFTIHSTFASRYVRTSFPRFKMPENSIPKEAAFQIINDELMLDGNPRLN
LASFVTTWMEPECDKLIMASVNKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGEAEAAV
GVGTVGSSEAIMLAGLAFKRKWQNKMKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELK
EVKLREDYLVMDPVKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLIEKNKQTGWDT
PIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKDDLPEE
LIFHINYLGTDQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKNVMENCRENMLVLKAGLE
KTGRFNIVSKDNGVPLVAFSLKNNSCHDEFEVSDYLRRFGWIVPAYTMPPDAQNVTVLRV
VIREDFSRTLAERLVIDIQKVLHELDTLPAKITAKIALNGENADKNVTVVTKKSAIETQR
EITTVWRKFVMEKKKMNGVC
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccaaagcaacctcaaattctgatgatttcaccattcactcaacctttgca
tctcgatatgttcggacctcatttcctagattcaaaatgccggagaactcgatccctaag
gaggcagcatttcaaatcattaacgatgagctgatgttggatgggaatccaaggctaaac
ctagcctcattcgtgaccacgtggatggagcccgaatgtgataagctcatcatggcttct
gttaacaagaattacgtcgacatggatgagtatccagtcactactgagctccagaatcgg
tgtgttaacatgatagcacatctcttcaatgcaccactgggagaagcagaggctgcagtt
ggagtaggaacggtggggtcatccgaggccataatgttggctgggttagcattcaaaagg
aagtggcagaacaagatgaaagcagagggtaaaccttatgacaaacccaacattgtcact
ggggccaatgtccaggtatgttgggagaaatttgcaagatactttgaagtagagttgaag
gaggtgaagctgagagaagattaccttgtgatggaccctgtgaaggcagtagagatggta
gatgaaaacaccatttgtgtcgctgctatcctcggttccactctcaacggagagtttgaa
gatgtaaagctcttaaacgatctcttgattgaaaagaacaagcaaactggatgggatact
ccaatccatgtggatgctgctagtggtggattcattgcaccatttctttacccagagctt
gagtgggatttccgattaccattggtgaagagcatcaacgttagtgggcataagtatggg
cttgtctatgccgggattgggtgggtcatttggaggagcaaagacgatttgccagaagaa
ctcatcttccatatcaattatcttggaactgaccaacccaccttcaccctcaacttctcc
aaaggttctagtcaagtcattgctcagtactatcaattaattcgcttgggttatgaggga
tacaagaatgttatggaaaattgccgagaaaacatgctggtactcaaagctggattggag
aagacaggccggtttaacatagtctcaaaagacaatggggtgccattggtggccttttct
ttaaagaacaatagctgccatgacgagtttgaggtgtcggactatttgcgacgctttggc
tggattgtgcctgcttacaccatgccacctgatgcccaaaatgtgacggttcttcgtgtt
gtcataagggaagacttttcgcgcactcttgccgaacgccttgtgattgatatccagaaa
gttttgcatgaacttgatacccttcctgctaagatcacggccaagatagcacttaatggt
gaaaatgctgacaagaatgtcactgtggttacaaagaagagtgctatagagactcagagg
gagatcactacggtttggaggaagtttgtcatggaaaagaagaagatgaacggtgtttgt
taa

DBGET integrated database retrieval system