KEGG   Quercus suber (cork oak): 112005067Help
Entry
112005067         CDS       T05868                                 

Definition
(RefSeq) uncharacterized protein LOC112005067
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00061  Fatty acid biosynthesis
qsu00780  Biotin metabolism
qsu01100  Metabolic pathways
qsu01212  Fatty acid metabolism
Module
qsu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    112005067
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    112005067
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:qsu01004]
    112005067
Enzymes [BR:qsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     112005067
Lipid biosynthesis proteins [BR:qsu01004]
 Fatty acid synthase
  Component type
   112005067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT MaoC_dehydrat_N
Motif
Other DBs
NCBI-GeneID: 112005067
NCBI-ProteinID: XP_023893083
LinkDB All DBs
Position
Unknown
AA seq 218 aa AA seqDB search
MAASAFSNSLLSSPSPPPHRPTFAWSPSRSQVNLRSTAFRSYPTLFTTRSSLDAANDTKQ
DTPIELRYAAFPTVMDINQIREILPHRFPFLLVDRVIEHNPGVSAVAIKNVTINDNFFPG
HFPERPIMPGVLMVEAMAQVGGLVMLQPEVGGSRENFFFAGIDKVRFRKPVVAGDTLVMR
MTLIKLQKRFGIAKMEGKAYVGGEVVCEGEFLMATGSE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctcagctttctccaattcacttctctcatctccttctcctcctcctcataga
cccacctttgcttggtctccatcacgatcacaagtcaatcttcgtagtactgctttcaga
tcgtatccaacccttttcaccacccgttcttctctggacgctgcaaatgataccaagcaa
gacacccctattgaattaagatatgctgcatttcctacagtgatggatatcaaccagatt
cgtgaaattctgcctcaccggttcccatttcttctagtggatagagtaattgaacacaat
cctggagtttcagctgttgctatcaagaatgtcacaattaacgacaatttctttcctggt
cattttcctgaaagaccgataatgcctggtgttctcatggttgaggcaatggcacaagtt
ggtggcttggttatgctgcaaccagaagttggaggttcccgtgaaaatttcttctttgct
ggtattgacaaagtgcgattccggaaaccagtggttgctggtgacaccctagttatgaga
atgacacttatcaagttgcagaaacgctttggaattgcaaagatggaagggaaggcatat
gttggaggggaggtcgtatgcgagggcgagtttttgatggctacaggcagtgaataa

DBGET integrated database retrieval system