KEGG   Quercus suber (cork oak): 112005193Help
Entry
112005193         CDS       T05868                                 

Definition
(RefSeq) transcription factor HY5
  KO
K16241  transcription factor HY5
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    112005193
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:qsu03000]
    112005193
Transcription factors [BR:qsu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   Plant G-box-binding factors
    112005193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Myosin_tail_1 Nnf1 GIT_CC DUF3563 GAS FlaC_arch TSC22 DUF737 UPF0242 Spc7 DMPK_coil DUF5320 Gal4_dimer Spc24 NRBF2 EMP24_GP25L APG6_N Phlebovirus_NSM Nup54 DUF1192 Ax_dynein_light YabA V_ATPase_I FmiP_Thoc5 DivIC DUF4407 PAXX M CASP_C
Motif
Other DBs
NCBI-GeneID: 112005193
NCBI-ProteinID: XP_023893213
LinkDB All DBs
Position
Unknown
AA seq 169 aa AA seqDB search
MQDQATSSIAANSLPSSSEISSSSALHLEVKEGMESDEEIRRVPEIGVESAGTSASGRET
GSVVGPDRVQVSGEAQRKRGRSPGDKESKRLKRLLRNRVSAQQARERKKAYLSDLETRVK
ELEKKNSELEERLSTLQNENQMLRHILKNTTASRRGGNNGASNANDGSL
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaccaagcaacgagttcaattgcagcgaattctctgccttcaagcagtgaaata
tcttcaagctctgctcttcatcttgaagtcaaggaaggtatggagagtgatgaggagatc
aggagggtaccggagataggagtggaatcggcggggacctcagcctcgggaagagagact
ggttcggtggtcggtccagaccgggttcaagtatcaggcgaagctcagagaaagagaggc
agaagtccaggtgacaaagaaagcaagcgactaaagaggttgctgaggaatagagtatca
gcacaacaagcaagggagaggaagaaggcatacttgagtgatttggaaacgagggtgaaa
gagttggagaagaagaattctgagctggaagagaggctgtccaccttgcagaatgagaat
caaatgcttagacatatattgaaaaacacaacagcaagcagaagaggaggaaataatggt
gctagtaatgccaatgatgggtccttataa

DBGET integrated database retrieval system