KEGG   Quercus suber (cork oak): 112007263Help
Entry
112007263         CDS       T05868                                 

Definition
(RefSeq) lysophospholipid acyltransferase LPEAT2
  KO
K13510  lysophosphatidylcholine acyltransferase / lyso-PAF acetyltransferase [EC:2.3.1.23 2.3.1.67]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00564  Glycerophospholipid metabolism
qsu00565  Ether lipid metabolism
qsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    112007263
   00565 Ether lipid metabolism
    112007263
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:qsu01004]
    112007263
Enzymes [BR:qsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     112007263
    2.3.1.67  1-alkylglycerophosphocholine O-acetyltransferase
     112007263
Lipid biosynthesis proteins [BR:qsu01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   112007263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyltransferase EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_7 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 112007263
NCBI-ProteinID: XP_023895362
LinkDB All DBs
Position
Unknown
AA seq 558 aa AA seqDB search
MADPDLSSPLLPSQPSDPPHLILTIHDSLSHNNNRESRVNHNHQNSHRNNGNSSIISSTE
NPYEFMGSKGLEVCGSSTVDPFLNKTGRIEGLYEWLKLVVCLPVAAVRLVLFGVCLLIGF
VATKVALYGWKDRQSPMPVWRSRIMWITRISARFILFSFGYHWIRRKGKPAPRETAPIVV
SNHVSYIEPIFYFYELFPTIVAAESHDSIPFVGTIIRAMQVIYVNRFLPPSRKHAVNEIK
RKASSDRFPRVLLFPEGTTTNGRILMSFQLGAFIPGYPIQPVIVRYPHVHFDQSWGNISL
AKLMFRMFTQFHNFMEVEYLPVVSPLTNQKETAVHFAKRTSHALATGLNVIQTSHSYGDL
MLLMKAIESKQEKPSNYMVEMAKVQSLFHISSLEAVDFLDKFLLMNPNPSGCVKFHDFLK
VLRLKACTLSEEIFSFIDVEKSGTITFKQFLFGSAHVMKLPLFRQACELAFAECKSGAND
YILEHELENLIRPAIPDLNADEVHELFNLFDSDSDGEISKDDFNTCLRKNPLLIALFIPC
LLQKGLPETCDRILEEVV
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccctgatctctcctctcctctcctcccttcccaaccctccgatccccctcat
ctaatcctcaccatccacgactccctctctcacaacaacaacagagaaagtcgtgtaaat
cacaatcatcaaaactctcaccgcaacaacggcaacagtagtattattagtagcacagaa
aacccatatgagtttatggggtctaagggtctggaggtatgtgggtcatccacagttgac
ccattcttgaacaagacgggtcggatcgaagggttgtacgagtggttgaagttggtggtt
tgtttgcctgttgcggcggtcaggctcgtcctctttggggtttgcttgttgattggcttt
gtggccaccaaagtagctctttatggttggaaagataggcaaagtcccatgcccgtttgg
aggtctagaatcatgtggatcaccagaatttcagccagatttattctcttctcttttggg
tatcattggataagaaggaaaggaaaacctgcacccagggagactgctccaatagttgta
tctaatcatgtatcatacattgaacctatcttttatttctatgagttattccctaccatt
gtggcagctgagtcccatgattccataccttttgttgggaccattatcagagcaatgcag
gtgatatatgtcaataggttcttaccgccatcaaggaagcatgccgtcaatgaaataaag
agaaaggcttctagcgatagatttcctcgagtactgttatttcctgagggaaccacaact
aatggaaggatccttatgtcattccaacttggtgcattcatccctggttacccaatccaa
cctgtaattgtccgttatcctcatgtgcactttgaccaatcatgggggaatatctctctg
gcaaagctcatgtttaggatgttcacgcagtttcacaattttatggaggtagaatacctt
cctgttgtttcacccctcactaatcaaaaagaaactgctgttcattttgctaagaggact
agtcatgctcttgctactgggcttaatgttatacaaacctctcattcctatggggactta
atgcttcttatgaaagcaattgaatcgaaacaggagaagccctcaaattatatggttgaa
atggctaaggtgcaatcattgttccatataagcagcttggaagctgtggacttcctggat
aaatttttgttaatgaatccaaacccaagtggttgtgtcaaattccatgacttcttgaag
gttctaagactcaaggcttgtactctttctgaagagatattttcattcattgatgtggag
aagagtggaacaatcacattcaagcagttcttatttggatcagcacatgtcatgaagctg
ccattattcaggcaagcttgtgaattagcctttgccgaatgcaagtctggagcaaatgat
tacatattagaacatgaattggaaaatttgatcagacctgcaatcccagacttgaatgca
gatgaggtccatgagctgtttaatttatttgattctgatagtgatggggagatcagcaag
gatgattttaatacctgtctaagaaaaaatcctctgctgatagcacttttcataccttgt
ttgctgcaaaagggattgccagaaacttgcgataggatactggaggaggtagtgtga

DBGET integrated database retrieval system