KEGG   Quercus suber (cork oak): 112014306Help
Entry
112014306         CDS       T05868                                 

Definition
(RefSeq) glutathione S-transferase U7-like
Organism
qsu  Quercus suber (cork oak)
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_C GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 112014306
NCBI-ProteinID: XP_023902458
LinkDB All DBs
Position
Unknown
AA seq 273 aa AA seqDB search
MSTNSNKPELDPNQGGDEKKKTYHKQATGEAWKTAQAHSVDNELKLYGSCFCPFVHRVWI
SLEHKGLDYQYVEVDVYRKPKLLLDINPRGLVPALRHGDWGSYESTVLMEYLEDLERGAP
LLPRDARLRAHSRLWSDHINRHIIPTFYRYLQAQETGEQARFATELTEAVAKLVDAADPR
GPYFLGAEMTFVDVQIAPWVVRMRTVLQPYRGWPEPEPGSRWERWVQALEGNEAVRKTTS
DDQLYLDSYERYAENRPNTSQVREAINSGRGLP
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccaacagcaacaagccagaacttgaccccaaccagggcggcgacgagaagaaa
aagacatatcacaagcaagctacgggggaggcttggaagaccgcccaagcacattccgtc
gacaacgaactgaagctctatggatcttgcttctgtccgtttgtgcaccgagtgtggatc
tccctagaacacaaaggattagactatcaatatgtagaggtcgacgtctaccgcaaacct
aaactcctgctcgacatcaacccacgcggcctcgtccccgctctccgccacggcgactgg
ggctcctacgaaagcaccgtgctgatggagtacctcgaagacctcgagcgcggcgccccc
ctgctgccccgcgacgccagactgcgcgcccactcgcgcctctggtccgaccacatcaac
cggcacatcatcccgaccttctaccgctacctccaggcgcaggagaccggcgagcaagcg
cgcttcgccacggaactgaccgaagcggtcgcgaagctcgtcgacgccgcggatccccga
ggcccatatttcctcggcgccgagatgacgttcgtggacgtccagattgcgccgtgggtg
gtgcgcatgcggacggtgctgcagccctaccgcggctggccggagcccgagccgggcagt
cgctgggagcggtgggtgcaggcgctcgagggcaacgaggcggtccggaagacgacgagc
gatgatcagctctacctcgacagctatgagcggtatgccgagaaccgacccaacacgagc
caagtgcgcgaagcgatcaactccggcaggggtctgccttga

DBGET integrated database retrieval system