KEGG   Quercus suber (cork oak): 112014807Help
Entry
112014807         CDS       T05868                                 

Definition
(RefSeq) uncharacterized protein LOC112014807
Organism
qsu  Quercus suber (cork oak)
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N Pyr_redox Pyr_redox_2 NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 112014807
NCBI-ProteinID: XP_023902965
LinkDB All DBs
Position
Unknown
AA seq 359 aa AA seqDB search
MMKAVRLHGQRDLRLEEIPVATCGRGQIKIAPAWCGICGTDLHEYLGGPSLCPKDTPHPL
TGETVPLTLGHEFSGVIEELGDGVDAKFRVSDRVCVQPILYDGSCGSCQEGLINCCDKNG
FLGLSGWGGGLSEHIVVPEYAVHQLPDNVPLDVAALVEPLSVGWHAVDVSPFVPTDSVLV
LGGGPIGLAIIQALRARNAHQIIVSELSSIRKQYAKEFGAHVVLDPTKDDIVARCKELTG
GRGVHVCFDAAGVQAGLDAAILALRARGTHVNVAIWEKPCTLSPNDLVFREKRYLGVATF
VKSDFREVIQAISDGRLDMCRKMITRRIGLDEVEKEGFQGLIRDKDSQVKIIVRSSGRI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagcggtgcgcctgcacggccagcgcgacctgcgcctggaagagatcccggtc
gcaacgtgcggccgcgggcagatcaagattgcgccggcgtggtgtgggatttgcggaacc
gatctgcacgagtacctgggcgggccgtcgctgtgtcccaaggacacgccgcatccgctg
acgggcgagacggtgccgttgacgctgggccacgagtttagcggcgtgatcgaagagctg
ggcgacggcgtggatgccaagtttcgcgtcagcgatcgagtctgtgtgcagccgattctg
tacgacgggagttgcggttcgtgtcaggaagggctgattaactgctgcgacaaaaacggg
ttcctgggcttgagcggctggggaggaggcttgtccgagcacatcgtcgtgccggagtac
gccgtgcatcagctcccggacaacgttccgctggacgtcgccgcgctcgtcgaacccctc
tccgtcggctggcacgcggtcgacgtctcgccgttcgtccccaccgattccgtgctggtc
ttgggaggaggacccatcgggctcgccatcatccaagcattgcgcgcgcgcaacgcccat
cagatcatcgtgtccgagctgtcgtcgattcggaagcagtacgcgaaagagtttggcgcg
cacgtcgtgctggatccgaccaaggacgacatcgtggcgcggtgcaaagagctgacgggc
ggtcggggcgtgcacgtgtgtttcgatgctgccggcgtgcaggcagggttggacgccgcg
atcctggcgctgcgagcacggggaacacacgtcaacgtagcgatctgggagaagccgtgc
acgctgtcccccaacgatctggtgttccgcgagaagcggtatctgggcgtggcgacgttt
gtcaagagcgacttccgagaggtcatccaggcgatctcggacggtcggctggacatgtgt
cggaagatgatcacgaggcgcatcgggctggacgaggtcgagaaggaggggtttcaggga
ctgatccgggacaaggactcgcaagtcaagatcattgtacgctcgtcagggaggatctga

DBGET integrated database retrieval system