KEGG   Quercus suber (cork oak): 112015198Help
Entry
112015198         CDS       T05868                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00010  Glycolysis / Gluconeogenesis
qsu00053  Ascorbate and aldarate metabolism
qsu00071  Fatty acid degradation
qsu00280  Valine, leucine and isoleucine degradation
qsu00310  Lysine degradation
qsu00330  Arginine and proline metabolism
qsu00340  Histidine metabolism
qsu00380  Tryptophan metabolism
qsu00410  beta-Alanine metabolism
qsu00561  Glycerolipid metabolism
qsu00620  Pyruvate metabolism
qsu00903  Limonene and pinene degradation
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112015198
   00053 Ascorbate and aldarate metabolism
    112015198
   00620 Pyruvate metabolism
    112015198
  09103 Lipid metabolism
   00071 Fatty acid degradation
    112015198
   00561 Glycerolipid metabolism
    112015198
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    112015198
   00310 Lysine degradation
    112015198
   00330 Arginine and proline metabolism
    112015198
   00340 Histidine metabolism
    112015198
   00380 Tryptophan metabolism
    112015198
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112015198
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    112015198
Enzymes [BR:qsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     112015198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 112015198
NCBI-ProteinID: XP_023903338
LinkDB All DBs
Position
Unknown
AA seq 539 aa AA seqDB search
MASWRIPSLLSRSFSSSSATLFSRGRSTSNLSRGIYKYSTAAAAAVDDPINPPVKVNYTQ
LLIGGQFVDAASGKTFQTLDPRTGDVIANVAEGDAEDVNRAVATARKAFDEGPWPRMTAY
ERQRVLLRFADLIEQHNDELAALETWDNGKPYEQAAKIEVPMLARLMRYYAGWADKIHGL
TVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFGWKVGPALACGNAIVMKTAEQTPLSAL
LAAKLLHEAGLPSGVLNVVSGFGPTAGAAIASHMDVDKLAFTGSTATGKVVLQLGAKSNL
KPVTLELGGKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKA
KARALNRSVGDPFKGGIEQGPQIDTDQFDKILNYINSGIESGATLETGGERFGNKGYYIK
PTVFSNVKDDMLIAKDEIFGPVQTILKYKDLDEVIRRANSTPYGLAAGVFTHNIDTANTL
TRALRVGTVWVNCFDTFDAAIPFGGYKMSGQGREKGIYSLSNYLQVKAVVTPLHNPAWL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttggaggatcccttcactgctctctcgttctttctcttcttcttcagctact
ctgttttctagaggtagaagtacttctaacttgagcagaggaatatataaatatagcact
gctgctgctgctgctgttgatgatccaattaatccaccggttaaagtaaattatacccag
cttttgattggtgggcaatttgtggatgcagcatcagggaaaacttttcagacattggat
cctaggacaggggatgtgattgctaatgttgctgaaggtgatgctgaggatgtaaatcga
gcagttgctactgctcgcaaggcatttgatgaaggaccatggccaaggatgactgcttat
gaaaggcaaagggtacttttgcgctttgctgatttaattgaacagcacaatgatgaactt
gctgcacttgagacttgggacaatggaaagccttatgaacaggccgccaaaattgaagtt
ccaatgttggcacgactaatgcgatactatgctgggtgggcggataagatccatggtctc
acagttccggctgatggaccgtaccatgtgcaaaccttgcatgaacctattggtgttgcg
ggccagattattccatggaattttcctcttctcatgtttggttggaaggttgggcctgca
ttagcatgtggcaacgctattgtaatgaaaacagcagagcagacaccattgtctgctctc
ttagcagcaaagctactgcatgaggctggacttccttctggtgttctaaatgtggtctct
ggttttggtccaactgctggtgcagctattgccagtcatatggatgtggataagcttgct
ttcactggatcaacagctacaggaaaagttgttcttcaattgggagcaaaaagcaatcta
aagccagttactttggaacttggagggaaatccccctttattgtatgtgaggatgctgat
gtagataaggctgttgagcttgcacactttgctttgttctttaatcagggacaatgctgc
tgtgctggatctcgtacatttgtacatgagcgtgtatatgatgagtttgtagagaaagca
aaggcacgtgctttgaatcgttctgttggcgatccattcaaggggggcatagaacaaggt
cctcagattgacacggatcaatttgacaaaatcctgaattacataaattctggaattgaa
agtggagctacccttgaaactgggggagagagatttggcaacaagggctattacattaag
cccacagtgttctcaaatgttaaggatgacatgttgattgcaaaagatgagatatttggt
ccagtgcagaccatcttgaaatacaaggaccttgacgaggtgattcgaagagcgaattcc
acaccatacgggcttgctgctggggtgtttacacacaacatagacactgctaacacttta
acacgcgcattacgagttgggacggtatgggtgaactgctttgatacatttgatgctgca
attccttttggtgggtacaagatgagtgggcaaggaagagagaaaggaatttacagtttg
agtaattacttgcaagtgaaggctgttgtcactcctttgcataatccagcatggctctaa

DBGET integrated database retrieval system