KEGG   Quercus suber (cork oak): 112019692Help
Entry
112019692         CDS       T05868                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00010  Glycolysis / Gluconeogenesis
qsu00030  Pentose phosphate pathway
qsu00051  Fructose and mannose metabolism
qsu00052  Galactose metabolism
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
qsu01200  Carbon metabolism
qsu01230  Biosynthesis of amino acids
qsu03018  RNA degradation
Module
qsu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112019692
   00030 Pentose phosphate pathway
    112019692
   00051 Fructose and mannose metabolism
    112019692
   00052 Galactose metabolism
    112019692
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    112019692
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:qsu01009]
    112019692
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:qsu03019]
    112019692
Enzymes [BR:qsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     112019692
Protein phosphatases and associated proteins [BR:qsu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112019692
Messenger RNA biogenesis [BR:qsu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     112019692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 112019692
NCBI-ProteinID: XP_023907973
LinkDB All DBs
Position
Unknown
AA seq 791 aa AA seqDB search
MAQVNLAPPAMPSGTKRIAVMTSGGDSPGMSGAVRAVVRQTIASGCTAYAVYEGYQGLVD
GGDMIKEMQWEDVRGWSSEGGTLIGTARCKAFMERAGRLTAANNMIEKGIDALVICGGDG
SLTGADKFRAEWPSLMEELVSSGKRKTEDVEPFRHLNIVGLVGSIDNDLSSTDATIGCYS
SLQRICQSIDYIDATAFSHQRAFVIEVMGRHCGWLALMAGVSCGADFIFIPENPPSENWE
QDMCDIVRKHREMGKRKTIVIVAEGAHDRNLTHISPNMVKDLLSNKVGLDTRVTTLGHVQ
RGGPPCAYDRMLSTLQGVEAVRAVLEATPETESPVICMVENKIVRKNLMEAIRVTKEVAD
NIEKKDFAAAMRGRDAEFEEFLQAFNITTDTENRNLLLPEEQRMRVGIIHVGAPAGGMNA
ATRAAVAYCLTKGHTPVALHNGFPGLVRHHDDQPLGSVREMTWLDAENWASRGGSEIGTN
RGLPSEDMDGVAFCFDKYKIDALFVVGGFEAFTAVAELRKARTDHDAFKIPMVVLPATVS
NNVPGTEYSIGSDTCLNALIEYCDAIKQSASASRRRVFVVETQGGASGYIATLAGLSIGA
LAVYTPEEGIHLNMLVEDIKFLKESFNLDKGNARSGKIILRNEKASRTYTTEIIANIIKE
ESGGKFDCRFAVPGHVQQGGTPSPMDRVRAVRFGVKSLQYLETYAGKSKQAIHDDQMSAA
VIGIRGARVKFSPMERIEREETDWKDRRPKQEFWMNIVNVVDTLSGRPQSSRGSVQDNPV
SPPQNARGAVR
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggtcaacctagctcccccggcaatgcctagcggcaccaaacgtatcgcggtc
atgacctctggcggcgactcgcccggtatgagcggcgctgtacgcgccgtggtgcgccag
acaatcgcgtccgggtgcactgcatatgctgtctacgagggctatcagggattggtggac
ggtggagacatgatcaaagagatgcaatgggaagacgtgcgcgggtggtcgtcggaaggg
ggaacactgattggcaccgcgcgttgtaaagcgttcatggagcgggctggacgtctgacg
gcggcaaacaacatgattgagaaaggcatcgatgcactggtgatttgcggtggtgatgga
tcgctgactggcgcggacaagtttcgtgcggagtggcccagcctcatggaggagctggtt
tcgagtgggaagcgcaaaaccgaggacgtggagcctttcaggcatttgaacattgttgga
ttggtgggatcgatcgataatgatctcagcagcacggatgccacgatcggatgttacagt
tcattacagcggatctgtcagtcgatcgactacatcgatgccacagcgttttcgcatcag
cgagcctttgtgatcgaggtgatgggacggcattgtggatggttagccctgatggctggt
gtgagctgtggtgcggatttcatcttcatccccgagaaccctccaagtgaaaattgggag
caggacatgtgtgatatcgttcggaagcatagagaaatgggtaagcgaaaaacaattgtc
atcgttgccgaaggagctcacgaccgaaaccttacgcacatctcaccaaatatggtcaag
gatttgctttccaataaagtcggcttggataccagagtcaccaccttgggccatgttcaa
cgaggtggtccgccatgcgcttatgatcgtatgctttccactctgcagggtgtcgaggca
gttcgggcggtgctggaagccacaccagagacggaatcgcccgttatctgtatggtcgag
aacaaaatcgtacggaaaaacctcatggaagccatcagagtcaccaaggaggttgccgac
aacatcgaaaagaaagattttgcggccgccatgcgcggaagagatgcggagtttgaagag
ttcctgcaggctttcaatattacgacagatacagagaataggaatttgttactgccagag
gagcagagaatgagggtggggatcattcatgttggcgctcctgctggcggcatgaacgct
gcaacaagagctgcagtggcgtattgcttgaccaaaggtcacactccagtcgcattacac
aacggttttccgggtttggtgagacatcacgacgatcaacctttgggctctgtgcgagag
atgacatggctcgacgcggaaaattgggcatcgcgtggtggatctgaaatcggtaccaac
cgcggtctaccatctgaagatatggacggcgtagcattttgctttgacaaatacaagatc
gacgcactgttcgtggttggcggctttgaagccttcacagctgttgcagagctacgaaaa
gcaaggacagaccacgatgctttcaaaattccaatggttgtactgccagctacagtttcg
aacaatgttccagggacagaatatagcattggttccgacacgtgcttaaacgccctcatc
gaatattgcgatgctatcaagcaatctgctagcgcgagtcggcgaagagtcttcgtcgtc
gaaacccaaggtggagcttccggttacatcgcgacacttgctggtctcagtataggagct
ctcgccgtgtacactcccgaggaaggtatccacctgaacatgcttgtcgaagacatcaaa
ttccttaaagagtcgttcaacctcgataaaggtaatgcgcgatccggcaaaatcatcctc
cgcaacgagaaagccagcagaacgtacacgaccgagatcatcgccaacatcatcaaagaa
gaatccggcgggaaattcgactgccgctttgccgtgccgggacacgtacagcaaggcggt
acaccttcccccatggaccgcgtgcgtgccgtacgtttcggcgtcaagtcgctgcaatat
ctcgagacttacgcaggcaagagtaaacaagccattcacgacgaccagatgtctgcagcc
gtcatcggcatccgaggtgcgcgcgtgaagttcagtccgatggagcggatcgagcgcgaa
gagacggactggaaggatcgaaggccgaaacaagagttctggatgaacattgtcaacgtc
gtcgacacgttgagcggccgaccacagagctctcgaggatctgtgcaggataatcccgtc
agtccaccacagaacgctaggggcgctgtgagatga

DBGET integrated database retrieval system