KEGG   Quercus suber (cork oak): 112023696Help
Entry
112023696         CDS       T05868                                 

Definition
(RefSeq) probable succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00020  Citrate cycle (TCA cycle)
qsu00190  Oxidative phosphorylation
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
qsu01200  Carbon metabolism
Module
qsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
qsu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
qsu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    112023696
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    112023696
Enzymes [BR:qsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     112023696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 TFIIE_beta DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 112023696
NCBI-ProteinID: XP_023912090
LinkDB All DBs
Position
Unknown
AA seq 646 aa AA seqDB search
MLSSGFRRFAAAGNLPRQLSRRNFSRSAPASKIITPNGPLRAKEASPFISNKYPIIDHEY
DALVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGVNAALGNMHEDDWRWH
MYDTVKGSDWLGDQDAIHYMTREAPASVIELENYGCPFSRTDDGKIYQRAFGGQSQKFGQ
GGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEFFAIDLIMEDGECKGVVAYNQEDG
TLHRFRAHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIYG
AGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPDKD
HIYLQLSHLPPEILHERLPGISETASIFAGVDVRKQPIPVLPTVHYNMGGIPTRYTGEVL
TVDEQGQDKVVPGLFACGEAACVSVHGANRLGANSLLDLIVFGRAVSHTIRDNFSPGQPH
KEISADAGAESVSIVDHVRTADGPKSTNEIRSAMQKVMQTDVSVFRTQESLDEGVEKIHK
VDKMWDQVGTKDRSMIWNSDLVETLELRNLLTCAVQTAEAAANRKESRGAHAREDYPDRD
DENWMKHTLTWQKKPQDKIDIGYRKVEANTLDANECKPVPPFARKY
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcttcaggcttccggcggttcgcggcagcgggcaacctgccccggcagctatcc
cgccgcaacttctcgcgctctgcacccgcgtccaaaatcatcacacccaatggccctcta
cgagcgaaggaggcgtcacctttcatcagcaacaagtaccccatcatcgaccacgagtat
gacgcgctcgttgtcggtgctggcggcgctggtctgcgtgcggctttcggtctggcagag
gctggcttcaacacggcttgcatatccaagctgttccccacacgatctcacaccgtggcc
gcacagggaggtgtcaatgctgcgcttggaaacatgcacgaggatgactggagatggcat
atgtatgacaccgtgaagggatccgattggctgggtgaccaagatgccatccactacatg
acccgcgaggctccagcatcggtcatcgagcttgagaactacggctgcccattctctcga
accgacgacggcaagatctaccagcgtgcgtttggtggtcaatcacagaaattcggccaa
ggtgggcaagcctaccgatgctgtgctgctgccgacagaactggtcatgccctcctgcac
accctctacggtcaatcgctccgccacaacaccaactacttcatcgagttcttcgccatt
gatctgatcatggaggatggcgagtgcaagggtgtcgtcgcctacaaccaagaagatggt
actctccaccgcttccgcgcccacaacacggtcttggccactggtggctacggtcgtgcc
tacttctcctgcacgtctgctcacacttgcactggtgatggaatggccatggtagctcgt
gctggccttcccaaccaggatctcgaattcgttcagttccacccaactggtatctacggt
gctggatgcctgatcaccgagggctctcgcggtgaaggtggatacctcctgaacagcgag
ggtgagcgattcatggagcgttacgcgccaacggctaaggatctcgcctctcgtgacgtc
gtctcacgttccatgaccatggagatccgtgagggccgtggtgttggtcctgacaaggat
cacatctacctgcagctgtctcacttgccgccggaaatccttcacgagcgtctgcctggt
atctcagagactgcctctatcttcgctggtgttgatgtccgcaagcagcctattccagtc
ttgccaactgtccactacaacatgggtggtatcccaactcgctacactggcgaggtgctc
accgtcgatgaacagggtcaggacaaggttgtgccaggtctcttcgcttgtggtgaggct
gcttgcgtgtctgtccacggtgccaaccgccttggtgccaactctctcttggacttgatt
gtcttcggtcgtgctgtcagccataccatccgcgacaacttctcacctggccaaccccac
aaggaaatctccgccgacgccggtgccgagtcagtcagcatcgtcgaccacgtacgaacc
gccgacggacctaagtccaccaacgagatccgcagcgccatgcagaaggtcatgcagacc
gacgtttcggtgttcagaacacaagagtcactggacgagggtgtcgagaagatccacaag
gttgataagatgtgggaccaagtcggcaccaaggaccgtagcatgatctggaacagcgat
ctcgtcgagacccttgagctccgtaaccttctgacctgcgccgtgcagaccgccgaggct
gctgctaaccgcaaggagtctcgcggtgcacacgcgcgcgaagattaccccgaccgtgac
gacgagaactggatgaagcacaccttgacctggcagaagaagccacaagacaagatcgac
atcggctaccgaaaggtcgaggccaacactctggacgcaaacgagtgcaagcctgtgccg
ccattcgcgagaaagtactag

DBGET integrated database retrieval system