KEGG   Quercus suber (cork oak): 112026516Help
Entry
112026516         CDS       T05868                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: hexokinase-2, chloroplastic
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00010  Glycolysis / Gluconeogenesis
qsu00051  Fructose and mannose metabolism
qsu00052  Galactose metabolism
qsu00500  Starch and sucrose metabolism
qsu00520  Amino sugar and nucleotide sugar metabolism
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
qsu01200  Carbon metabolism
Module
qsu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
qsu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112026516
   00051 Fructose and mannose metabolism
    112026516
   00052 Galactose metabolism
    112026516
   00500 Starch and sucrose metabolism
    112026516
   00520 Amino sugar and nucleotide sugar metabolism
    112026516
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    112026516
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:qsu04131]
    112026516
Enzymes [BR:qsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     112026516
Membrane trafficking [BR:qsu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    112026516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 112026516
NCBI-ProteinID: XP_023914974
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MSTVTATSPAVGSFCIPRSRGRINMPRFTMTVRSSNAVSAGVAPILTKFKHDCATPLPLL
RHVADAMAADMRAGLAVDGGSDLKMILSYVDTLPTGNERGLFYALDLGGTNFRVLRVQLG
GKEERVIATEFDQVSIPQELMFGTSEELFDFIASGLAKFAEKEGGKFHLPPGRKREIGFT
FSFPVRQTSIDSGILIKWTKGFAVSGTAGRDVVACLNEAMDRQGLDMQVSALVNDTVGTL
AGARYWDDDVMVAVILGTGTNACYVERMDAIPXLQGHVSPSGRTIVNTEWGAFSNGLPLT
VFDKDMDAASINPGEQIFEKTISGMYLGEIVRRVLLKMAAEGALFGESVPEKLSTPFVLR
TPDLSAMQQDNSDDLNVVGSILYNIAGVESNLSARKIVLEVCDTIVMRGGRLAGAGIVGI
LQKMEEDSTGLIFGKRTVVAMDGGLYEHYRQYKRYLKDAVKEILGLEKSKNVVIEHTKDG
SGIGASLLAASNSKYEHDF
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgtcacagcaacctccccagccgtcggatcgttttgtattccgagatcacgg
gggcgcatcaatatgcctcggttcaccatgaccgtccgatctagtaacgctgtctctgct
ggcgttgccccaatcttgaccaagtttaagcacgactgtgctacccctctgccccttttg
cgccacgtggcggatgcaatggccgctgatatgcgcgctggtcttgccgttgatggcggg
agtgatctcaagatgatcctcagctatgttgatactctccctactgggaatgagagaggg
ttgttttatgctttggatcttggtggcacaaacttccgggtgctaagggtgcagttaggt
gggaaggaagagcgtgtgatcgctaccgagtttgatcaagtgtccatacctcaagagctc
atgtttggtacctctgaggagctttttgattttatagcttctgggttggcaaaatttgca
gaaaaggagggtggaaagtttcatctgccacctggaaggaaaagggagattggattcaca
ttctcttttcctgtgaggcagacgtctatagactctggcatactaatcaagtggacaaag
ggttttgccgtctctggaacggcaggaagagacgtagtggcttgtttaaatgaggctatg
gataggcaaggactggatatgcaggtgtctgccctggttaatgatactgttggaacatta
gctggagcaagatactgggatgatgatgtcatggttgctgtcattttgggtactggaacc
aatgcttgctatgttgaacggatggatgctattccttaactgcagggtcatgtgtcccct
tctggaagaacgattgttaatactgagtggggagcattctcgaatggtcttcctttaact
gtttttgataaagacatggatgctgctagtattaatcctggtgagcagatctttgagaag
acaatctctggaatgtatcttggtgaaattgtacgaagagtgctactaaagatggctgca
gaaggagccttgtttggtgaatctgttccagaaaaactatccactccatttgtactccgg
actccagatctttctgccatgcagcaggacaactcagatgatcttaatgttgttggatca
atcctctataacattgctggggttgagagcaacttaagtgcaaggaagattgtcctagag
gtttgcgacactattgtgatgcgaggtggccgtttagctggtgcaggaattgtggggatt
ctgcaaaagatggaagaggattcaacaggtctcatctttgggaagaggacggtggtggct
atggatggaggcttgtatgagcattaccgtcagtacaaaagatacttaaaagatgctgtt
aaagagattttagggttggaaaaatcaaagaatgtggttatagaacacacaaaagacggg
tctggtataggggcttctctccttgctgcttcaaactccaaatatgagcacgacttctag

DBGET integrated database retrieval system