KEGG   Quercus suber (cork oak): 112028194Help
Entry
112028194         CDS       T05868                                 

Definition
(RefSeq) DNA ligase 6-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu03030  DNA replication
qsu03410  Base excision repair
qsu03420  Nucleotide excision repair
qsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    112028194
   03410 Base excision repair
    112028194
   03420 Nucleotide excision repair
    112028194
   03430 Mismatch repair
    112028194
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:qsu03032]
    112028194
   03400 DNA repair and recombination proteins [BR:qsu03400]
    112028194
Enzymes [BR:qsu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     112028194
    6.5.1.6  DNA ligase (ATP or NAD+)
     112028194
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     112028194
DNA replication proteins [BR:qsu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    112028194
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     112028194
DNA repair and recombination proteins [BR:qsu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     112028194
   NER (nucleotide excision repair)
    Other NER factors
     112028194
   MMR (mismatch excision repair)
    Other MMR factors
     112028194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C Lactamase_B_2 RMMBL UBA_4 CDT1_C
Motif
Other DBs
NCBI-GeneID: 112028194
NCBI-ProteinID: XP_023916627
LinkDB All DBs
Position
Unknown
AA seq 1428 aa AA seqDB search
MASSSKTLTLDSSQLFLAALQSQSLPPPSPLSPIPSSFPPSKLIPNTRFLVDAFRGDSSF
SVSYFLSHFHSDHYAGLSATWSKGIIFSSPTTALLLNRVLKLPSPFVVPLPLRQTVVIDG
CQITLIDANHCPGAVQFFFNIPGPNGGRYVHTGDFRLSDSMRFDSFLTQFIGSDAVFLDT
TYCNPKFVFPSQDESIDYVVSVIDRVRVGGDSLRDVLFLVATYVVGKERILLEIARRCNR
KIHVDARKMEVLRVLGYGESGLFTEDVCESDVHVVGWNVLGETWPYFRPNFVKMKEIMDE
RGYSKVVGFVPTGWTYEVKRNKFAVRTKDSFEIHLVPYSEHSNYDELREYVKLLKPKRVI
PTVGLDVENLDSKHADKMQKHFAGLVDEMANKQEFLRGFYRGSCEVVNKVERDASTNEEL
DKENEIKETKAKGSDINDPGFALDNSSSPKEPGTQDPVVLNDEDISSLQQSSSQDPVMLN
DEDMEKLVQELRDCLPTWVTHNQILDLISTSGRNIVEAVSNFYERETEFHEQVLASTATT
SVSTSQSSSLNVSASLSKAGFVMSSPIGSIDNALSKVYKSANLKHSRPGKGKGTIDKKPN
KKVKVNSIKSGTSPGKRKMNVENKTNKKVNSKLESGGSKQSTITSFFSKVLPDVSEGGKV
GTLFEQSPIDENLLPDDSAKFYRDEIDQFIQIINGNESSRSCAATILEKTKGDINKALDI
YFCNHEGDLGDSNKSVLVQSSVNNCSPGQKKNVLGKEHVPDISLQSTLTKDVDATPVSLP
PEQYNPIEHACWRSGQPAPYIHLARTFDQLEDEKGKIKATSMLCNMFRSLLALSPEDVLP
AAYLCTNKIAADHENIELNIGGSLVSSALEEACGTNRTKLKEMYNKIGDLGDVAQECRQT
QTLLAPPSPLLIRDVFSALRKISGQTGSGSTVRKKNVIVNLMCSCREKEMKFLVRTLVRN
LRIGAMMRTVLPALAQAVVFNSSPNFYHEGKVDNLKENLQFLSAAVVEAYNILPNLDLVV
PSLMNKGVKFSSSTLSMIPGIPIKPMLAKITNGVPQALKLFQNKAFSCEYKYDGQRAQVH
KLVDGTVRIFSRNGDESTSRFPDVINIIKESCRPAAMTFILDAEVVAVDRKNGFKLMSFQ
ELSSRGRGSKDNLITVDSIKVDICVFVFDIMFANGQQLLGFSLRKRRKYLKDLFHDEKLG
YFEYAKEMTVEADDACLTNEVTLNKISSFLEDAFSSSCEGLVVKLLDFDAEYSPSKRTDT
WLKVKRDYVEGLCDSLDLVPIGAWHGNGRKAGWYSPFLMACYNPDTEEFQSVCRVMSGFS
DSFYIEMKGFFSGDKILSKKPPYYRTAEVPDKWFSPELVWQIRGADFTLSPVHQAAIGLV
HPSRGISIRFPRFINPVSDRNPEESSTAADIAEMFQSQTRKMDVTSEA
NT seq 4287 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttcctcgaaaaccctaaccctggactcctcccagctcttcctggccgctctc
caatcccaatcattaccaccaccatcgcccctctctcccattccctcctctttcccccct
tcgaaactcatccccaacacccgtttccttgtagacgccttccgcggcgattccagtttc
tccgtctcctacttcctctcccacttccactctgatcactacgccggcctctccgccacc
tggtccaaaggcatcatcttctcttcccccaccaccgcccttctcctcaaccgtgttctc
aaactcccctccccctttgtcgtccctttaccgctccgccaaactgttgtcattgacggc
tgtcagatcaccctcattgacgccaatcattgccctggtgccgtccagttcttcttcaac
attcctggccccaacggtggcaggtatgttcacaccggcgattttcgcttatctgattcc
atgagatttgactcttttctaactcaatttattggctctgacgctgttttcttggatact
acttattgtaatcccaaattcgtgtttccttcgcaagatgagtctattgattatgttgtt
agtgtgatcgatagagtaagagtaggaggtgattcattgagggatgttttgtttcttgtc
gctacttatgttgttgggaaagagaggattttgctcgagattgcacggaggtgtaatcgg
aagatacacgtcgacgctaggaagatggaggttttgcgtgttttggggtatggtgagagc
gggttgtttacagaggacgtgtgtgaaagtgacgttcatgttgttgggtggaatgttttg
ggtgagacatggccgtattttaggcctaatttcgtgaaaatgaaggagatcatggatgaa
agaggctactctaaggttgtgggttttgttcccacagggtggacttatgaagtgaagcgc
aataagtttgctgtcagaactaaggattcctttgagattcatcttgttccgtatagtgaa
cattcaaactatgacgaacttagggaatatgtgaagttattaaaaccaaagcgtgtcatt
cctaccgtgggtttggatgttgaaaaccttgatagcaagcatgccgataaaatgcaaaag
cattttgcagggttagttgatgaaatggccaataagcaagagttcttaaggggtttttat
cgagggtcctgtgaagtggttaacaaggttgaaagagatgccagcactaatgaggagctg
gacaaggagaatgagatcaaggaaactaaggcaaagggcagtgatattaatgatccgggt
tttgctttggataactcatcttctcctaaagaacctggtacacaagatccagttgttttg
aatgatgaggatatatcttctcttcaacaatccagttcacaagatccagttatgctgaat
gatgaggacatggagaaactcgttcaggaacttcgtgattgtttgcccacatgggtcact
cacaaccagatattagatctgattagcacctccggaaggaatattgttgaagcagtgtct
aatttttatgaacgtgaaactgaatttcatgagcaagtccttgctagtacagctacaaca
tctgtgtccacttctcaaagtagctcacttaatgtctccgcttcactttcaaaagcaggt
tttgttatgagtagtcctattggaagcattgacaatgctttaagtaaagtctataagtca
gccaacctgaagcattctcgtcctggcaaaggtaaggggactattgacaagaaaccaaac
aagaaagttaaagtcaattcaattaagagtggcacttctcctggaaaaaggaagatgaat
gttgagaataagacaaacaagaaggttaattcaaagttggaatctggtggttcaaaacaa
tctacaataacaagtttcttcagtaaagttttgcccgatgtttctgaaggtggtaaggta
ggaactttgtttgagcagagccctatagatgaaaatctgttgcctgatgattctgccaaa
ttttacagggatgaaatagaccagtttattcaaataataaatggcaatgaatcatccaga
agctgtgctgccaccattctagagaagacaaaaggagatattaataaggcgctggatatt
tacttctgtaatcatgagggtgaccttggtgactccaacaaatcagttctggtgcagagt
agtgtcaacaactgctctcctggccaaaagaagaatgtgctagggaaagaacatgttcct
gatatctctttgcagtcaacgttaacaaaggatgtggatgcaactcctgtatcactacct
ccagaacaatacaatcctatagagcatgcatgctggaggagcggacaacctgctccatat
atacatcttgcaagaacttttgatcagctagaggatgaaaaagggaagataaaagctact
tctatgttgtgtaatatgttcagaagtttactggccttgtctcctgaggatgtgctgcct
gctgcatatttatgcacaaataagatcgctgcagaccatgaaaatatagaactaaacatt
ggtggaagtttggtctcctcagcactggaagaggcatgtggtacaaaccggaccaaatta
aaggagatgtataacaagattggtgatcttggtgatgttgctcaagaatgccgacaaaca
caaacattacttgcccctccttcgccgcttctaattagagatgtattttctgcactccga
aagataagtggacaaacaggcagtggaagtaccgttcgaaagaaaaacgttattgtgaat
ctcatgtgttcttgtagagagaaggagatgaagtttcttgttagaactttggtcagaaat
ttacggattggagcaatgatgagaactgttttacctgctctagctcaagccgttgttttt
aattcctcccctaacttttaccatgaaggaaaagtagataatttgaaggagaatcttcag
ttcctttctgcagccgtagttgaagcctataatatactccccaatttggatctggttgtt
ccttctctcatgaacaaaggtgtcaagttttcttcttcgactttgtcaatgattccagga
atacccatcaagcctatgcttgcaaaaatcaccaatggtgttccgcaagcactgaagctc
ttccagaataaagctttttcatgtgaatataaatatgatggtcagcgtgcccaagttcac
aaattagttgatggaactgttcgcatattttcacgaaatggagatgaatcgacctcaaga
tttccggatgtgattaatataataaaggaatcatgcaggcctgctgcaatgactttcatt
ttggatgcggaggttgttgcagttgataggaagaatggcttcaaacttatgtctttccaa
gaattatcttctcgagggagaggaagcaaagataacttgattacagtggatagcataaag
gttgacatttgcgtgtttgtcttcgatatcatgtttgctaatggacagcagctgttgggt
ttctctctccgcaaaagacgaaaatatttgaaggatttgtttcatgatgagaagttggga
tatttcgaatatgcaaaggaaatgacagttgaagcagatgatgcttgtttgaccaatgaa
gtcacattaaataagataagctcttttcttgaagatgcattcagctcctcatgtgaaggg
cttgtggtcaaattattagattttgatgctgaatattctccatctaagcggactgacaca
tggttaaaggtcaagcgagactatgttgaaggattgtgtgattctcttgatttagtccca
attggtgcctggcatggaaatgggagaaaagctggatggtacagtccatttcttatggca
tgttacaaccctgacacggaggaattccaaagtgtatgccgcgtcatgtccgggttctct
gattctttttacatagagatgaaaggtttcttttctggggacaagattctgtccaaaaag
ccaccttattatcgaacagctgaggtgcctgataagtggttttcgccagaacttgtttgg
caaataagaggtgcagacttcacactttcaccagttcatcaggctgccattggtttagtt
catccatctcgtggtatttcaatacgattccccagattcatcaatcctgtgtctgataga
aatccagaagaatccagcacagctgcagatatagccgaaatgtttcaatctcagactcga
aagatggatgtgacatctgaagcttga

DBGET integrated database retrieval system