KEGG   Quercus suber (cork oak): 112032781Help
Entry
112032781         CDS       T05868                                 

Definition
(RefSeq) ent-kaurene oxidase, chloroplastic-like
  KO
K04122  ent-kaurene oxidase [EC:1.14.14.86]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00904  Diterpenoid biosynthesis
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    112032781
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:qsu00199]
    112032781
Enzymes [BR:qsu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.86  ent-kaurene monooxygenase
     112032781
Cytochrome P450 [BR:qsu00199]
 Cytochrome P450, plant type
  CYP701 family
   112032781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Got1
Motif
Other DBs
NCBI-GeneID: 112032781
NCBI-ProteinID: XP_023921304
LinkDB All DBs
Position
Unknown
AA seq 460 aa AA seqDB search
MANITHFLQDFQATPFATSFAVGGLSLLISFFFIRGFRLTKKNEYSKLPPVPVVPGLPVV
GNLLQLKEKKPYKTFLRWAEIHGPIYSIRTGASTMVVLNSTHVAKEAMVTRFSSISTRKL
SKALELLTSNKSMVATSDYNEFHKMVKKYIIAELLGANAQKRHRIHRDTLIENVSNKLHA
HIKNSPLQAVNFRKIFESELFGLAMKQALGYDVESLFVEELGTTLSREEIFNVLVSDMLK
GAIEVDWRDFFPYLKWIPNKSFEMKIQSLASRRQAVMNSIVKEQKKRIASGKDRLYQEIQ
NVCGTDKITEEHLSKLPYLSAVFHETLRKHSPSPLVPLRYAHEDTQIGGYYVPAGTEIAV
NIYGCNMDKNQWETPEEWKPERFLDKKYDPMDMYKTMSFGSGKRVCAGSLQASLIACTSI
GRLVQEFEWRLKDGEVENVDTLGLTTHKLYPMQAILKPRN
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggccaacataactcattttcttcaagatttccaagcaacgccctttgcaacctctttt
gctgttggtggtctctctttgcttatttccttcttcttcatacgaggatttcgtttaacc
aagaagaatgaatattccaaactccctcctgttccagtggttccagggctgccagtggta
ggaaatttgctgcaactgaaggagaagaaaccttacaagacgttcttaaggtgggctgag
atacatggaccaatctattccatcagaactggtgcttccactatggttgtcctcaattcc
acccatgttgccaaagaggctatggtgaccagattttcatccatctcaacaagaaagtta
tcaaaggccctagagcttctcaccagtaataaatctatggttgcaacaagtgactacaat
gagtttcacaagatggtaaagaaatatataatcgcagagcttctgggagctaatgcacag
aagcgacatcgaatccacagagacactctgatagaaaatgtttcgaacaaattacatgct
catataaagaactctcctcttcaagctgtgaatttcaggaaaatatttgagtctgaactt
tttggactggcaatgaaacaagctttgggatatgatgtggaatcactttttgtggaagag
cttggaaccactttgtcaagagaagagatatttaacgttctagtgtctgacatgttaaag
ggtgcgattgaggttgattggagagatttcttcccatatctaaaatggattccaaataag
agctttgaaatgaaaattcagagtttggcttcccgcagacaagcagtgatgaattccatt
gtcaaggagcagaagaagcgcattgcttcaggaaaggatcgtctttatcaggaaatccaa
aatgtttgtgggactgacaagattactgaggaacacttgtctaagcttccatacttgagt
gctgttttccatgaaactctgaggaagcacagtccaagtccattagtacctttgcgatac
gcacatgaagacacccaaataggagggtactatgttcctgcagggactgagattgctgta
aacatatacgggtgtaacatggacaagaatcaatgggaaacccctgaagagtggaagcca
gagaggtttcttgataagaaatacgatccaatggatatgtacaagacgatgtcatttgga
agtggaaagagagtatgtgcaggttcacttcaggcatcgttaatagcgtgcacatcaatt
ggtaggttagtacaggaatttgagtggaggctgaaagatggagaggtggaaaacgtggat
actcttggactcactactcacaaactctatcccatgcaagcaattctaaagcctaggaat
taa

DBGET integrated database retrieval system