KEGG   Quercus suber (cork oak): 112033159
Entry
112033159         CDS       T05868                                 

Definition
(RefSeq) spermidine hydroxycinnamoyl transferase isoform X1
  KO
K13065  shikimate O-hydroxycinnamoyltransferase [EC:2.3.1.133]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00940  Phenylpropanoid biosynthesis
qsu00941  Flavonoid biosynthesis
qsu00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
Module
qsu_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    112033159
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    112033159
   00941 Flavonoid biosynthesis
    112033159
Enzymes [BR:qsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.133  shikimate O-hydroxycinnamoyltransferase
     112033159
SSDB
Motif
Pfam: Transferase RHH_7
Other DBs
NCBI-GeneID: 112033159
NCBI-ProteinID: XP_023921708
LinkDB
Position
Unknown
AA seq 449 aa
MVVSLKNCCTVKPAEPTWNGPQPLSELDQVGTTTHVSTIYFYRPTQNWLSPPDTITNTLK
ESLSKALVPFYPIAGRLRWIGKGRLQINCNAEGVQFFEAESESKLEDFGDFSPCPEYEYL
IPSVDYSVPIHEMPLLLVQLTKFKCGGISLSLLVSHAVVDGPSALHFFSEWSRIARGEPL
ETSPFHDRRVLRAGDPPRASPCIDHEGFIQPPLLLGKLDSLEERKKKTTVAMLKLTKTQV
EKLKKMANEDQSSDLECGYTRYETLAGHIWRCACKARKHGNEQPTALGVCVDSRRRMSTP
LPIGYFGNATLDVVATSRAGDLISKSLSYASSRIREAIKKVNDEFVNSGIDFLKNQPDLT
PFQDFHSVGSTQGPFYGNPNLGVVSWLTIPIYGLDFGWGKEIYMGPGTHDFDGDSLVLPS
HDGDGALIVALCLQVAHMDDFKKHFYEDI
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggtagtaagcttaaagaattgctgcacagtaaagccagcagagccaacatggaatggc
ccccaacccttatcagaattagatcaagttggtaccacaactcatgtttccacaatctat
ttctaccgtccaacacaaaactggctttcaccaccagacaccattaccaatactcttaaa
gagtcattaagcaaagcattggtgcctttctatccaatagctggtcgtttgcgttggata
ggcaaaggccgtcttcaaattaattgcaatgctgaaggggttcaattctttgaagctgaa
tctgagtccaaattagaagattttggtgacttctctccctgtccagagtatgagtacttg
atcccaagtgtagattacagtgtcccaattcatgaaatgccattattattggtgcaactc
actaagttcaagtgtggaggcattagtcttagcctattggtatcacatgctgtggttgat
ggaccaagtgcactacacttcttttcagagtggtctaggattgcccgaggtgagccatta
gagacatcaccatttcatgatcgaagggttttaagagctggggatcccccaagagctagt
ccatgcattgaccacgaggggtttattcaacccccactcttgctcgggaaattggatagt
cttgaagagcgaaagaagaagactacggtggccatgttaaagcttacaaaaacccaagtt
gaaaagctaaagaagatggcaaatgaggatcagagtagcgatttagagtgtggttacaca
cggtatgagactttggcggggcacatttggagatgtgcatgcaaagctcgtaaacatgga
aatgaacaacctacggcattaggtgtttgtgttgactcaagaaggcgcatgagtacacca
ttgccaattgggtactttggcaatgcaactttggatgtggttgctacgagtcgtgccggg
gatttgatttccaaatcattaagctatgcttcaagtaggataagagaggctatcaagaaa
gtgaatgatgagtttgtgaattcgggtattgattttttgaagaatcaaccggacttgaca
ccgtttcaagactttcattccgtggggagcacccaagggcctttctatggaaatccaaat
cttggggttgtgagctggttgactataccaatctatggccttgattttggatgggggaag
gagatttatatggggccaggaacacatgattttgatggagactcgcttgtccttccgagt
catgatggagatggagcattgattgtggctttgtgtctgcaagtggctcatatggatgat
tttaagaagcacttctatgaagatatttag

DBGET integrated database retrieval system