KEGG   Quercus suber (cork oak): 112038575Help
Entry
112038575         CDS       T05868                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00250  Alanine, aspartate and glutamate metabolism
qsu00410  beta-Alanine metabolism
qsu00430  Taurine and hypotaurine metabolism
qsu00650  Butanoate metabolism
qsu01100  Metabolic pathways
qsu01110  Biosynthesis of secondary metabolites
Module
qsu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    112038575
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    112038575
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    112038575
   00430 Taurine and hypotaurine metabolism
    112038575
Enzymes [BR:qsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     112038575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 GST_C_6
Motif
Other DBs
NCBI-GeneID: 112038575
NCBI-ProteinID: XP_023927166
LinkDB All DBs
Position
Unknown
AA seq 503 aa AA seqDB search
MVITTTIPDSDEHLDSTFASRYVRTPVPKYKMPANPIPKEAAYQIINDELMLDGTPRLNL
ASFVTTWMEPECEKLMMASINKNYVDMDEYPVTTELQNRCVNMIARLFNAPVGETDTAVG
VGTVGSSEAIMLAGLAFKRKWQSKRKLEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSEGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFENVKLLSELLTEKNKETGWDTP
IHVDAASGGFIAPFIYPNLEWDFRLPLVKSINASGHKYGLVYPGVGWVVWRTKEDLPDDL
VFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFVRLGFEGYKNVMENCLENARALKEGIEK
TGLFNIVSKDDGVPLVAFSLKDSSKYDVFEISGSLRRFGWIVPAYTMPPNAEHIAVLRVV
IREDFSRALAERLISDIVKVMKEMETHPIRVSTKTAHVTATVDETQDGDDGGKKHIKKSA
RETPEEIATYWRQLVARKRTGIC
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggtaatcacaaccacaattccagactccgacgagcatttggactctacttttgcttcc
agatatgtccgtactcccgttcccaagtacaagatgcctgcgaatccaataccgaaagaa
gcagcatatcagataataaatgacgagttgatgctggatgggacacccaggctgaacttg
gcttcatttgtgaccacgtggatggagcctgaatgcgagaagcttatgatggcctccatc
aacaaaaactatgttgacatggacgaataccctgttaccaccgagctccagaatcggtgt
gtgaatatgatagcccgcctttttaatgctcctgttggagaaactgatactgctgttggt
gtgggtactgtgggatcatcagaggcaataatgctggcaggtctagcttttaaaaggaag
tggcagtcgaagagaaaattagagggcaaaccatatgataagcccaacatagtcactgga
gctaatgttcaggtttgctgggagaagttcgccaggtactttgaggttgaactgaaggag
gtaaaactgtcagagggatattatgtgatggatcctgtgaaagcagttgagatggtggat
gagaacaccatctgtgttgcagcaattctgggatcaaccttgactggagagtttgagaat
gtgaaactccttagtgaactcctcactgaaaagaataaggagacaggatgggacacccca
attcatgttgatgccgctagtggcggttttattgccccattcatttaccctaatcttgag
tgggatttccgtttgcctttagtgaagagcataaatgctagtggtcataagtatggcctt
gtctaccctggtgttggctgggttgtttggaggactaaagaggacttacctgatgacctt
gtctttcacatcaactatcttggatctgatcaacccacattcaccctcaacttctccaaa
ggctctagtcaaatcattgctcaatattatcagtttgttcggctgggctttgagggttac
aagaacgtcatggagaattgcttggagaatgccagagcactgaaagaaggaattgagaaa
acggggttgtttaacattgtctccaaggatgatggagtacccctggtagccttctctctc
aaagacagtagcaaatacgatgtgtttgagatatcagggagtttgagaaggtttgggtgg
atcgttccagcctacacaatgccacctaatgctgaacacattgctgttcttcgtgtagta
attagagaggatttcagccgggccttggctgagagacttatttcagacatagtgaaagtt
atgaaggagatggagacacaccccatccgtgtttccaccaaaactgcccatgtcacagct
actgttgatgaaacacaagacggagatgatggaggcaaaaagcacataaaaaagagtgcg
agggagactccggaggagatagccacctactggaggcagcttgtggctcgcaagagaact
ggaatttgctag

DBGET integrated database retrieval system