KEGG   Quercus suber (cork oak): 112039440Help
Entry
112039440         CDS       T05868                                 

Definition
(RefSeq) protein SET DOMAIN GROUP 41
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
qsu  Quercus suber (cork oak)
Pathway
qsu00310  Lysine degradation
qsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:qsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    112039440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:qsu03036]
    112039440
Enzymes [BR:qsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     112039440
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     112039440
Chromosome and associated proteins [BR:qsu03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     112039440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 112039440
NCBI-ProteinID: XP_023928085
LinkDB All DBs
Position
Unknown
AA seq 631 aa AA seqDB search
MEMEMEMEMEMRAREDIEIGEDITPPIPPLSYALHHSFLHSHCYSCFSPLPLPLPLNSNY
NNTKNHHHYYYCSPACTTTRVVSTEELHILQSHPHHPFSSDLRAALRFLQSHPDDRIAGL
LTNCRKLLLLQEDDEFAATIHEGAKAIATATATATASASAALCLVLTNGVEVQDYDGRNL
GIAVYPQNFSWINHSCSPNASYRFFLSPPPPCCSNSTKLRILPQHTVLTKDDEVCQDNGP
KIVVRSIKRIKQGEQVTVTYTNLLQPKKMRQSELWSRYRFICRCERCSASPPTNVDHTLQ
EISSANLDASSLSSDQNVYRDYAIRTLTDYIDDAITQYLSFGDPELCCEKLEILLTQGLL
YEQLEGREVKSQPTIKLHPLHYLCLNAYTTLASAYKVRASDLLGLYSELDEHLLEALDLS
RTSAAYSLLLAGATHHLFRFESSLIATVANFWISAGDSLLTLSRSPVGSEFAKWDLPIAN
PPLLKCICSKCSLMDNFKAILFHREAQNADFEDISSEFLDCVTIITQKVWSFLIHGCRYL
RAFKDPIDFSWLGTSKYSSLRDVQPHLCSTAEGPGYNLQERMHIFQLGVHCLLYGGYLAS
ICYGRHSHLTSQVQNILDCEECLINDSHETD
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggagatggagatggagatggagatggagatgagggcgagggaggacatagaaataggg
gaagatataacacctccaatacccccactctcatacgctctccaccactcattcctacac
tcccactgctactcctgcttctcccctctccctctccctctccctctaaattctaattac
aataatactaaaaaccaccaccattactactactgctcccctgcctgtactactactagg
gtcgtctccaccgaagaactccacatccttcaatcccacccccaccaccccttctcctct
gacctccgtgctgccctccgcttcctccaatcccatcctgatgatcgcatcgccggtttg
ctcaccaactgccgcaaactactcctactccaagaggacgatgagtttgctgccacaatt
catgagggcgccaaagccatagccacagccacagctacagccacagcttcagcctcagct
gcactgtgccttgtgctaaccaatggtgtggaggtgcaggattatgatgggcgcaatctg
ggtatagcagtatacccacaaaacttctcatggatcaatcacagctgctctcccaacgct
tcttaccgctttttcctctctccaccgccaccctgttgctccaactccaccaagcttcgg
attcttccccaacatactgtattaacaaaagatgatgaggtgtgccaggataatggtccc
aaaattgttgttaggagtattaagaggattaagcaaggggagcaagtcactgttacctac
actaacttgttgcagcctaagaaaatgaggcaatcagagttatggtcaaggtatcgattt
atctgccgttgtgagcgatgtagtgcttcacccccaaccaatgtggatcatactctgcag
gaaatttcttcagcaaatcttgatgcttccagtttgagttctgatcaaaatgtctatcgt
gactatgcaataagaacgctgactgattacattgacgatgctataactcagtatctttca
tttggtgatcccgaattgtgttgtgagaagcttgaaatcttgttgacacaaggtctcctt
tatgaacagttagaaggcagggaagtaaaatcacaaccaaccatcaagttgcatcccctg
cactacctctgtctaaatgcctatactacactggcttcagcatataaagtccgtgcaagt
gacttgttgggtctatattctgaattggatgagcatcttttggaagctctggacttgagc
aggaccagtgcagcatactcattattgcttgcaggtgctactcaccatctgtttcgcttt
gaatcttctctaattgcaacagttgcaaatttctggataagtgctggggactccttatta
accctttctagaagtcctgtagggagtgagtttgcaaaatgggatctgcctatagcgaac
ccgcctctcttgaaatgcatatgctctaagtgctcactaatggataattttaaagccatt
ctatttcatagagaagctcaaaatgcggattttgaggatatatctagtgagttccttgat
tgtgtcactatcattacacaaaaggtttggagttttcttattcatggttgccgttatttg
agagcatttaaagatcctattgactttagctggcttggaacttcaaaatattccagctta
agggatgttcagcctcatctttgcagcactgctgaaggacctggttacaacctccaagaa
aggatgcatatcttccagcttggtgtccattgcttactgtatggagggtatttagcaagc
atatgttacggtcgacattcccatttgacaagtcaggttcaaaatattctagactgtgaa
gagtgtttgataaatgattcacatgaaacagattga

DBGET integrated database retrieval system