KEGG   Rahnella aquatilis HX2: Q7S_02825Help
Entry
Q7S_02825         CDS       T01850                                 

Definition
(GenBank) bifunctional glutamine-synthetase adenylyltransferase/deadenyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
raa  Rahnella aquatilis HX2
Brite
KEGG Orthology (KO) [BR:raa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Q7S_02825
Enzymes [BR:raa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     Q7S_02825
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     Q7S_02825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase
Motif
Other DBs
NCBI-ProteinID: AFE56830
UniProt: H8NPF4
LinkDB All DBs
Position
618012..620849
Genome map
AA seq 945 aa AA seqDB search
MLPLSSVLQSHAQSLLERWREHPENLPLPDDAQLAVLSSSEFVTDSLLAFPQWWHEIDQN
PPQAQEWQLYRQWLEESLTQVADEAGLMKALRLFRRRILTRIAWSQSAQTSEAKDTLHQL
SELAELLIVSARDWLYDACCREFGTPVNAAGEPQRMLILGMGKLGGGELNFSSDIDLIFA
YPENGQTRGGRRELDNAQFFTRLGQRLIKVLDQPTIDGFVYRVDMRLRPFGDSGPLVMSF
PALEDYYQEQGRDWERYAMVKARLMGGAEDISSQELRKMLMPFVFRRYIDFSVIQSLRNM
KGMIAREVRRRGLKDNIKLGAGGIREIEFIVQVFQLIRGGREPALQQRALLPTLQALENL
GLLPVEQVLQLRNSYLFLRRLENLLQAIADEQTQTLPSDELNQARLAWGMNYAGWPQLLD
AVNAHMQAVRSVFNELIGDDTPDAEDDVQLSQFSSLWIDALEPAELAPLVPQLDENAQRH
VLYQIADFRRDVDKRTIGPRGRDQLDLLMPRLLAQVCTYKNADVTLQRLMQLLLNIVTRT
TYIELLVEYPGALKQLIRLCAASPMVASQLARHPLLLDELLDTRTLYQPVEPGAYRDELR
QYLMRVPTEDEEQQLEAVRQFKQAQHLRIAAGDISGALPVMKVSDHLTYLAEAILDVVVQ
QAWEQMVVKYGQPAHLQHREGRGFAVVGYGKLGGWELGYSSDLDLVFLLDCAPEVMTDGE
RSIDGRQFYLRLAQRIMHLFSTRTSSGILYEVDPRLRPSGASGMLVSTIEAFADYQANEA
WTWEHQALVRARVVYGDPQLTQQFNATRRDILCRQRDGEGLRKEVREMREKMYAHLGSKK
ADEFDLKADPGGITDIEFIAQYLVLRFAHDEPKLTRWSDNVRIFELMAQHDIMPEEEARN
LTQAYVTLRDEIHHLALQEHSGKVAADSFAAERAQIRASWANWLG
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgttgccactttcttctgttttgcaaagccatgcgcagagtttgcttgaacgctggcgt
gaacatcctgaaaacctgccccttcccgatgatgcgcaactggccgtgctgagcagcagt
gaattcgtaacggacagtttgctggcttttccgcagtggtggcatgaaattgaccaaaat
ccccctcaggcgcaggagtggcaactttaccgccagtggctggaggaatcgctgacacag
gtggctgacgaagccgggctgatgaaagcgttacgtctgtttcgtcgtcgcattctgacc
cgcattgcgtggtcgcagtccgcgcaaaccagtgaagcgaaagacacgcttcaccagttg
agtgaactggcggaattattgattgtcagcgcccgcgactggctttacgacgcttgctgt
cgcgagtttggtacgccggtcaatgctgctggcgaaccgcaaagaatgctgatcctcggg
atgggtaaactgggcggcggcgagctgaatttctcctcggatatcgatctgatttttgcc
tatccggaaaatggtcagacccgcggcgggcggcgtgaactggataatgcacagtttttc
acccgtctcggtcagcggctgatcaaagtgctggatcagcccactatcgacggttttgta
tatcgcgtggacatgcgtttgcgcccgttcggcgacagcggcccgctggtgatgagcttc
ccggcactggaggattattatcaggaacaggggcgtgactgggagcgttacgcgatggtg
aaagcgcgtctgatgggcggcgcggaggacatcagcagtcaggaattgcgcaaaatgctg
atgccatttgtcttccgccgttatatcgatttcagcgtgatccagtccctgcgtaacatg
aaaggcatgatcgctcgtgaagtacgccgccggggtctgaaagacaacatcaaactcggc
gcaggcggtatccgtgagattgaatttatcgtgcaggtattccagctgatccgtggcggg
cgcgaaccggcattgcagcagcgtgcgttgctgccaacgcttcaggcgctggaaaatctg
gggctgttgccggtagaacaggtgttgcagttgcgtaacagctatctgttcctgcgccgt
ctggaaaatctgttacaggcaatagcggacgagcaaacacaaaccttaccgtcagatgaa
ctgaatcaggcacgtctggcgtgggggatgaattatgccggctggccgcagcttctggat
gcagtgaatgctcacatgcaggccgtgcgctcggtgtttaacgagctgattggtgatgac
acgccagatgctgaagatgatgtgcaactctcccagttcagcagtttatggattgatgcg
cttgagcctgccgagctggcgccactggtgccgcaacttgacgaaaacgcgcaacgacat
gttttatatcagattgccgatttccgccgtgatgtagataaacgcacgatcgggccgcgt
ggtcgtgaccagctggatttgctgatgccgcgtttgctggcgcaggtctgcacctataaa
aatgccgatgtgacgttacagcgcctgatgcagttgctgctcaatatcgtcacacgtacg
acgtatatcgagctgctggtggaataccccggtgcgctcaaacagttaatccgcctgtgc
gccgcttcaccgatggtcgcgagccaactcgcccgccatcctttattgctcgatgaactg
ctcgacacacgcacgctttaccagccggtggagccgggcgcgtaccgcgacgaactgcgc
cagtatctgatgcgggtgccgacggaagacgaagaacaacagcttgaagcggtacgtcag
ttcaagcaggcgcagcatctgcgtattgcagccggggatatttccggcgcattgccggtg
atgaaagtcagtgaccatttaacctaccttgcggaggccattctcgacgttgtggtgcaa
caggcgtgggaacagatggtcgtaaaatacggtcagccagcgcatcttcagcaccgtgaa
gggcgcggttttgccgtggtcggttacggaaaactcggtggctgggagctgggttacagc
tcggatctggatctggtcttcctgctcgactgtgcgccggaggtgatgaccgatggcgaa
cgcagcatcgacgggcgtcagttttatctgcggctggcgcagcgcatcatgcatttattc
agcacccgtacgtcgtcaggcattctttatgaggttgacccgcgtctgcgaccttccggt
gcctccggcatgctggtcagcaccatcgaagcttttgccgattatcaggccaatgaagcc
tggacatgggagcatcaggcgctggttcgcgcgcgcgtggtttacggtgatccgcaactg
acgcagcaatttaatgccacgcgtcgcgacattctttgccgccagcgcgatggtgaagga
ctgcgtaaggaagtccgtgaaatgcgcgagaaaatgtatgcccatctgggcagtaaaaaa
gccgacgagttcgatctgaaagccgatccgggtggcattacggatattgaattcattgca
caatatctggttctgcgtttcgcgcatgatgagccgaagctgacgcgctggtccgataat
gtgaggatttttgagctgatggcgcaacacgacatcatgccggaagaagaggctcgaaat
ctgacgcaggcttatgtcacgctgcgcgatgaaattcatcacctcgctttgcaggagcac
agcgggaaagtggccgcagacagttttgcggcggagcgcgcgcaaatccgcgccagctgg
gcgaactggctgggctga

DBGET integrated database retrieval system