KEGG   Rahnella aquatilis HX2: Q7S_04675Help
Entry
Q7S_04675         CDS       T01850                                 

Definition
(GenBank) xylose isomerase domain-containing protein TIM barrel
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00040  Pentose and glucuronate interconversions
raa00051  Fructose and mannose metabolism
raa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Q7S_04675
   00051 Fructose and mannose metabolism
    Q7S_04675
Enzymes [BR:raa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Q7S_04675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AFE57191
UniProt: H8NRD4
LinkDB All DBs
Position
1010846..1011739
Genome map
AA seq 297 aa AA seqDB search
MLQMIERAATVKGLTHLDLNYPQHMTGDITLMRQKIEEVGLAVNGMQMRWDAPEFKIGAF
THPDPKIRRQAIELTKRGIDAGREFGASIMTLWMGQDGFDYCFQADYKKIWEDAVSAVRE
VAEYAPDIDVSIEYKPNEPRAYSIFPNATTCLLAVEEAGCKNLGITLDFAHVLFANEVPA
FAAAMVARRSRLLGLDLNDGWGKRDDGLMVGSVNPRATLEFLLQMKRDGYKGAYYFDTFP
DASGLDPVREAETNIATVIRLLKLCEKLENNPALNEAISRQDAVATQQIVNDVMLAQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcaaatgatcgaacgtgcagctacggttaaaggattgacgcatctggacctgaat
tatccgcagcacatgaccggcgatatcactttgatgcgccagaaaatcgaagaagtcggg
ctggcggtgaacgggatgcaaatgcgctgggatgctccggaatttaaaatcggcgcattt
actcacccggatccaaaaattcgtcgtcaggcgattgaattgaccaaacgcgggatcgac
gccggtcgtgagtttggtgctagcattatgacgttgtggatgggacaggatggctttgat
tactgtttccaggctgactacaaaaaaatctgggaagacgcagtcagcgctgtgcgtgaa
gtggcggaatacgccccggatatcgacgtcagcattgaatacaaacccaacgaaccacgc
gcttacagcattttcccaaatgccactacctgtctgctggcggttgaagaagccggttgc
aagaacttaggtatcacactggatttcgcgcatgtgttgtttgccaacgaagtaccggcg
tttgcggcggcgatggtagcccgtcgttcgcgtttgctggggctcgatctcaatgacggc
tggggcaaacgcgacgacggcctgatggtcggctccgtcaacccgcgtgccacgctggaa
ttcctgttgcagatgaaacgcgacggctataaaggcgcgtattacttcgataccttcccg
gacgccagcggattggatccggtgcgtgaagcagaaaccaatatcgcgaccgtgatccgt
ttactcaaactttgcgaaaaactcgagaataacccggcgctgaatgaagccatcagcagg
caggacgccgtagccacacagcaaatcgtcaacgacgtgatgttggcgcagtaa

DBGET integrated database retrieval system