KEGG   Rahnella aquatilis HX2: Q7S_17450
Entry
Q7S_17450         CDS       T01850                                 

Definition
(GenBank) galactitol-1-phosphate dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00052  Galactose metabolism
raa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:raa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Q7S_17450
Enzymes [BR:raa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     Q7S_17450
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C TrkA_N Glu_dehyd_C 2-Hacid_dh_C Shikimate_DH Methyltransf_25 3HCDH_N MTS PrmA CoA_binding UDPG_MGDP_dh_N ELFV_dehydrog Methyltransf_31 F420_oxidored Pyr_redox_2 Sacchrp_dh_NADP XdhC_C Pyr_redox AAA_27 Met_10 GFO_IDH_MocA ADH_N_2
Other DBs
NCBI-ProteinID: AFE59703
UniProt: H8NWE2
LinkDB
Position
3810394..3811443
AA seq 349 aa
MKSVVVHADSRITIEEQPAPTLSAPDEVLVRIAYSGLCGSDIPRIFASSSHFYPITLGHE
FSGHVVSTGEEVSDLYEGDAVACVPLLPCFQCEECRKTAYSQCKHYQFIGSRRSGGHAEF
IVVSRKNLFKLPENFSLLQGAFLEPLTVGLHALKLAGGCEGKEVIVIGAGTIGQLLIQAA
SALGAKSVTAIDINPQRLSLAQETGASHVYNSAICNADEIRQQTHERRFNQLIIETAGTA
QTVALSLNIAGPKAQIALVGTLHKDLTLDVTTFGHILRKELTLLGSWMNYSSPWPGSEWR
LAIQLFAENKLNLAPLIASVARPAEFVRDVTALAGKPMTGKILLDMTGG
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaatcagttgttgtacatgctgacagcaggataactattgaagagcaaccggctccc
acgctgagtgcacccgatgaggttctggttcgcattgcctactccgggctttgcggatcc
gatatcccgcgtattttcgccagcagttcacatttttatcccatcacattaggccacgaa
ttcagtggtcacgtcgttagcaccggagaagaagtcagcgatttatatgagggtgatgcc
gtggcctgcgtacctttattgccatgctttcagtgcgaagagtgccgcaaaacagcgtat
tcccaatgtaagcattatcaatttattggctcccgacggagtggcggccatgctgaattt
atcgtggtttcgcgtaaaaacttatttaaattgccggagaatttttcacttctgcaaggc
gcttttttggaaccgctcaccgttggcttgcatgccctgaagctggcaggaggctgtgag
ggtaaagaagtgatagtcattggagccggcaccatcgggcagttgcttattcaggcagcc
agcgccctgggggctaaatcggtgacagcgatcgatatcaatccgcagcgcctttccctg
gcgcaggaaacaggtgccagccacgtttataacagcgcaatatgcaacgccgatgaaatc
cgccagcaaactcatgaacggcgctttaatcagctgattattgaaacagcaggcacagcg
caaaccgtggccttgtctctcaatatcgcaggccccaaagcgcaaatcgcgctggtcggc
accttacacaaagacctgactttagacgtcactactttcggccatatcctgcgcaaagag
ctgaccttgctcggcagttggatgaactattcctctccgtggccgggcagtgagtggcga
cttgccatacagctttttgctgagaataaactaaacctggcccccctgatcgccagtgtt
gcccgtcccgcagagtttgtcagggacgtcacggcactggctggcaagccgatgacggga
aagattttgctggatatgacgggaggctaa

DBGET integrated database retrieval system