KEGG   Rahnella aquatilis HX2: Q7S_21080Help
Entry
Q7S_21080         CDS       T01850                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa00071  Fatty acid degradation
raa00280  Valine, leucine and isoleucine degradation
raa00281  Geraniol degradation
raa00310  Lysine degradation
raa00362  Benzoate degradation
raa00380  Tryptophan metabolism
raa00410  beta-Alanine metabolism
raa00640  Propanoate metabolism
raa00650  Butanoate metabolism
raa00903  Limonene and pinene degradation
raa00930  Caprolactam degradation
raa01100  Metabolic pathways
raa01110  Biosynthesis of secondary metabolites
raa01120  Microbial metabolism in diverse environments
raa01130  Biosynthesis of antibiotics
raa01200  Carbon metabolism
raa01212  Fatty acid metabolism
Module
raa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:raa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Q7S_21080 (fadB)
   00650 Butanoate metabolism
    Q7S_21080 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Q7S_21080 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Q7S_21080 (fadB)
   00310 Lysine degradation
    Q7S_21080 (fadB)
   00380 Tryptophan metabolism
    Q7S_21080 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Q7S_21080 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Q7S_21080 (fadB)
   00281 Geraniol degradation
    Q7S_21080 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Q7S_21080 (fadB)
   00930 Caprolactam degradation
    Q7S_21080 (fadB)
Enzymes [BR:raa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Q7S_21080 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Q7S_21080 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Q7S_21080 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Q7S_21080 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AFE60425
UniProt: H8NU79
LinkDB All DBs
Position
4627167..4629359
Genome map
AA seq 730 aa AA seqDB search
MLYQGETLHLHWLDGGIAELVFDAPGSVNKLDTQTVASLGEAIAVLEKQSDLKGLLLSSA
KPAFIVGADITEFLSLFNAPAEKLHEWLDFANSIFNRLEDLPVPTLSAISGYALGGGCEC
VLATDFRISTADARIGLPETSLGIMPGFGGSVRLPRLIGTDSALEIIAAGKNISGKEALK
VGLVDAVVEADKLRDAGISMLRNAVDGKLEWHNRRDPKRLPLKLSQIEAAMSFSVAKSMV
MQNAGKHYPAPMSAVKTIEAAARLGRDEALQLETASFVPLAQSKEARALVSIFLNDQFVK
SKAKKLAQDSEKPKQAAVLGAGIMGGGIAYQSALKGVPVVMKDINDQSLTLGMNEAAKLL
NKQLERGKLDGLKMAKVLSTIHPTLDYSGIERASVVVEAVVENPKVKAAVLAEAESLLGT
DTVLASNTSTIPIDLLASSLKRPENFCGMHFFNPVHRMPLVEIVRGEKTSDKTISRIVSY
ALAMGKTPIVVNDCPGFFVNRVLFPYFSGFSLLLRDGADFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPERMARDYRDAVDVLFDNRRFGQKNQLGFYRYSEDSKGKP
RKEVDEQAISLLADNLKPAHTDFSPQDIIARMMIPMINEVVRCFEEGIIASPAEADMALV
YGIGFPPFHGGPFRYLDTLGTTEYLKMTEQYAHLGPMYQAPEGLRAKAQTNESYYPVAAP
LENFSTGNQA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaggcgaaacactacacctgcactggctcgacggcggtatcgcggagctg
gtgtttgatgccccaggctcggttaacaagctcgacacccaaactgtcgccagcctgggc
gaagccattgcagtacttgaaaaacagtctgacctgaaaggtctgctgctcagttcggcc
aaaccagcgtttatcgtgggcgcggatatcaccgaatttttatccctgttcaacgcgcca
gccgaaaaactgcatgaatggctggatttcgccaacagcatttttaaccggctggaagac
ctgccggtaccgacactttctgccatcagcggttatgcgctgggcggcggttgcgaatgc
gtgctggcgacagattttcgtatcagcactgccgatgcccggattggcctgccggaaacc
agtttagggattatgccgggcttcggcggttccgtacgtctgccacgtctgattgggacc
gatagtgcgctggaaattatcgccgccggtaaaaatatcagcggaaaagaggccctgaaa
gtcgggctggtcgatgcagtggttgaagccgataaactgcgcgacgctggcatcagcatg
ctgagaaacgccgttgacggcaaactggaatggcataaccgtcgtgatcctaaacgtctg
ccgttgaaactgagccagattgaagcggcgatgagcttcagcgtcgccaaaagtatggtc
atgcaaaatgccggtaaacactatccggcgcccatgagcgcggtgaaaaccatagaagcc
gcggcccgtctgggtcgtgatgaagcgttgcagctggaaaccgccagctttgtgccgctc
gcacaatcaaaagaagcccgcgcactggtcagtattttccttaacgatcagtttgtgaaa
agcaaagccaaaaaactggcgcaagacagcgaaaaaccaaaacaggccgccgtattgggc
gcgggcattatgggcggcgggatcgcctaccagtctgcgctgaaaggcgtgccggttgtg
atgaaagatatcaacgaccagtccctgacgctcggcatgaacgaggctgccaagttgctg
aacaagcaactggagcgcggtaaactcgacggtctgaaaatggctaaagtgctgtcgacc
attcatccgacgctggattacagcggcatcgaacgtgcctctgtggtcgttgaagccgtg
gtcgagaatcctaaagtgaaggccgcggtgctggcggaagcggaatctctgctcggcacc
gataccgttctggcctcgaatacctcgaccattcctatcgatctgttggcgtcttcgctc
aaacgcccggaaaacttctgtggtatgcacttcttcaacccggtgcatcgtatgccgctg
gtcgaaatcgtgcgtggtgagaaaacctcagacaaaacgatttcgcgcatcgtttcttac
gcactggcgatgggtaaaacgcctatcgtggtcaacgactgcccgggattcttcgtcaac
cgcgtactgttcccgtatttctccggtttcagtctgttactgcgtgatggcgctgatttc
cgccagatcgacaaagtgatggaaaaacagttcggctggccgatgggtccggcttatctg
ctggatgtggtcggcatcgacaccgcgcatcacgcccaggccgtgatggccgccggtttc
cctgagcgcatggcacgggattaccgtgacgctgttgatgtgctgtttgataaccgtcgt
tttgggcagaaaaatcaactcggtttctaccgttacagcgaagacagcaaaggcaagccg
cgcaaggaagttgacgaacaggcgatcagtctgctggccgacaacctgaaaccagcacac
actgacttctcaccgcaggacatcatcgcccgcatgatgattccgatgattaacgaagtg
gtgcgctgctttgaggaaggcattattgccagcccggccgaagccgacatggcgctggtt
tacggcatcggattcccccctttccacggcggcccgttccgttatctcgataccctcggt
accactgagtatctgaaaatgactgaacagtatgcacatctggggccgatgtatcaggca
ccggaagggctacgcgccaaagcgcaaaccaatgaaagttactatccggttgccgctccg
ctggaaaacttcagcaccggtaatcaggcataa

DBGET integrated database retrieval system