KEGG   Rahnella aquatilis HX2: Q7S_22475Help
Entry
Q7S_22475         CDS       T01850                                 

Gene name
pstB
Definition
(GenBank) phosphate transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
raa  Rahnella aquatilis HX2
Pathway
raa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:raa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Q7S_22475 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:raa02000]
    Q7S_22475 (pstB)
Enzymes [BR:raa01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Q7S_22475 (pstB)
Transporters [BR:raa02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Q7S_22475 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_22 RsgA_GTPase AAA_16 Rad17 AAA_23 AAA_30 AAA_33 PRK AAA_25 TniB Adeno_IVa2 G-alpha AAA_28 PhoH ATPase_2 AAA_5 AAA_14 RNA_helicase AAA NACHT
Motif
Other DBs
NCBI-ProteinID: AFE60700
UniProt: H8NUS3
LinkDB All DBs
Position
4946901..4947668
Genome map
AA seq 255 aa AA seqDB search
MTDASNSKIQVRDLNFYYGKFHALKNISLDIAKNEVTAFIGPSGCGKSTLLRTFNKMYQL
YPEQHAEGEILLDGENILVDKQDIALLRAKVGMVFQKPTPFPMSIYDNIAFGVRLFEKLS
RTDMDERVQWALTKAALWNESKDKLHQSGYSLSGGQQQRLCIARGIAIRPDVLLLDEPCS
ALDPISTGRIEELITELKSDYTVVIVTHNMQQAARCSDRTAFMYLGELIEYSDTDSLFTS
PARKQTEDYITGRYG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgcatccaacagcaaaattcaggttcgcgatctgaacttttattacggcaaa
ttccacgcgctgaaaaatatttccctggatattgctaagaacgaagtcacggcattcatc
ggcccgtcaggctgtggtaaatccacgctgctgcgtacgtttaacaaaatgtaccagctg
tatccggaacagcacgctgagggtgaaatcctgcttgatggcgaaaacattctggttgat
aagcaggacatcgcgctgctgcgcgccaaagtcggcatggtcttccagaaaccgacgcca
ttcccgatgtcgatttacgacaacatcgcgtttggtgtccgtctgtttgaaaagctgtcc
cgtacggatatggacgagcgtgtgcaatgggcgctgaccaaagctgcattgtggaatgaa
tctaaagacaagttgcaccagagtggttacagcctgtccggcggccagcaacagcgtttg
tgtattgcacgtggtattgcgatccgtcctgacgttctgctgctcgatgaaccttgctcg
gcgctcgatccgatttctaccggccgtatcgaagagctgatcaccgagttaaaatctgat
tacaccgtggtgatcgtgacccacaacatgcagcaggctgcgcgttgttcagatcgcact
gcgtttatgtatctgggcgaactgatcgaatacagcgacactgactcgctgttcacttca
ccagcgcgcaaacagactgaagattacattactggccgctacggttga

DBGET integrated database retrieval system