KEGG   Rahnella aquatilis HX2: Q7S_23996
Entry
Q7S_23996         CDS       T01850                                 

Definition
(GenBank) cytochrome P450
Organism
raa  Rahnella aquatilis HX2
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AFE60953
UniProt: H8P0J3
LinkDB
Position
PRA1:251430..252746
AA seq 438 aa
MPDNAQAIPFFIPPSSQFARLGFLKIAEMACRQHGDKVWIGEKDNAVLLLAGARHVRLLI
EQESQFVKEFEHLSSASTIGRILLGQSLTTSKEGEEWRLARKLTTPLVNPKSPLLKQSTD
LSARWLLDILQDPQQTSLREICLHWALMCVAEGFFGREISLAQLNTLIGHFRDIYLQLII
AAPDADYEALCRHPALVAFRLEAESLLGPLLDDARGGNTTMLERLCQALSPGAHPEARER
VINLLLGNLAASVDNTGIALLWTLTHLSQHLNYQHCVREEAVQGKRNMASAIVRESLRLT
PVTAFFERRVAENIVVDDVVITAGTRVLFSPWLIHRHAACWAEPLCFRPERFLGEEKIAP
EHFLPFSVGKRNCVGMTLALDQLTTAVATLCEHFQFSLAPSTSPAALTPLFALNVIPRGD
LSFILTSTNKAEQHDHIP
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgcctgataacgcgcaagccatcccttttttcatcccgccttcctcgcagtttgcccgg
ctcggttttcttaaaatcgccgaaatggcctgtcgtcagcacggagataaagtctggatt
ggtgaaaaagacaatgcagtgctgctgcttgccggcgcccgccatgtccggttgctgatt
gagcaggaaagccagttcgtgaaggaatttgaacatctttcctcagcctcaactatcgga
cgcatcttgctgggccagtcactgacgacatccaaagaaggcgaggaatggcggctggca
aggaaactcaccacaccgctggtgaaccctaaatccccgttgctgaaacaaagcaccgac
ctctccgcccgctggctgctggatattctgcaggatccgcagcagacctcattgcgtgaa
atctgcctgcactgggcgctgatgtgtgtggcggaaggattttttggccgggagatcagt
ctggcccaactgaatacgctgattggccatttccgtgatatctatctgcaactgattatc
gccgcaccggacgcggattatgaggcactgtgcaggcatccggcactggtcgccttccgg
ctggaggctgagtccctgcttggcccgttgctggatgacgccaggggcggcaataccacg
atgctggaacgtctttgtcaggcgctcagtcccggcgcgcaccccgaagcgcgtgagaga
gtgatcaatcttctgctgggcaatcttgccgccagcgtcgataacacgggtattgccttg
ctatggacgctgacacatctttcgcagcacctgaactatcagcactgcgtgcgtgaggaa
gcggttcagggcaaacgaaacatggcctcagccattgtccgggaatcgctccgtctgacg
ccggtgacagcgttttttgagcgccgggtggcagaaaatatcgtggtggatgacgtggtg
attacggcgggcacgcgggttttattttccccctggctgattcaccgtcatgccgcctgc
tgggcagaaccgctttgcttcaggccggaacggtttctgggtgaagagaaaattgcgccg
gagcattttttaccctttagcgtcggaaaacgaaactgtgtgggcatgactctggctctc
gaccagctgaccacggcggtcgcgacactgtgcgaacattttcagttttcgctcgcccct
tcgacgtcacctgccgccctcaccccgctttttgcgcttaatgtcatcccgcgcggtgac
ctgtctttcattctcacgtccacaaacaaggctgaacagcatgaccacatcccgtga

DBGET integrated database retrieval system